Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281441_WB13.jpg WB (Western Blot) (Western blot-P90RSK Polyclonal Antibody)

Rabbit P90RSK Polyclonal Antibody | anti-P90RSK antibody

P90RSK Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
RPS6KA1; RSK; HU-1; RSK1; p90Rsk; MAPKAPK1A
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
P90RSK, Antibody; P90RSK Polyclonal Antibody; RPS6KA1; HU-1; MAPKAPK1A; RSK; RSK1; p90Rsk; ribosomal protein S6 kinase A1; anti-P90RSK antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.23 mg/ml (varies by lot)
Sequence Length
744
Applicable Applications for anti-P90RSK antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human P90RSK (NP_002944.2).
Immunogen Sequence
LGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
Positive Samples
HT-29, HeLa, MCF7, K-562, Mouse Lung, Mouse Brain
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot-P90RSK Polyclonal Antibody)

product-image-AAA281441_WB13.jpg WB (Western Blot) (Western blot-P90RSK Polyclonal Antibody)

WB (Western Blot)

(Western blot-P90RSK Polyclonal Antibody)

product-image-AAA281441_WB15.jpg WB (Western Blot) (Western blot-P90RSK Polyclonal Antibody)
Related Product Information for anti-P90RSK antibody
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 72kDa; 81kDa; 82kDa; 83kDa
Observed: 90kDa
NCBI Official Full Name
ribosomal protein S6 kinase alpha-1 isoform b
NCBI Official Synonym Full Names
ribosomal protein S6 kinase A1
NCBI Official Symbol
RPS6KA1
NCBI Official Synonym Symbols
RSK; HU-1; RSK1; p90Rsk; MAPKAPK1A
NCBI Protein Information
ribosomal protein S6 kinase alpha-1
UniProt Protein Name
Ribosomal protein S6 kinase alpha-1
UniProt Gene Name
RPS6KA1
UniProt Synonym Gene Names
MAPKAPK1A; RSK1; S6K-alpha-1; p90-RSK 1; p90RSK1; p90S6K; MAPK-activated protein kinase 1a; MAPKAP kinase 1a; MAPKAPK-1a; RSK-1
UniProt Entry Name
KS6A1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The P90RSK rps6ka1 (Catalog #AAA281441) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The P90RSK Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's P90RSK can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the P90RSK rps6ka1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "P90RSK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.