Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200242_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: PADI2Sample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit PADI2 Polyclonal Antibody | anti-PADI2 antibody

PADI2 antibody - middle region

Gene Names
PADI2; PAD2; PDI2; PAD-H19
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PADI2, Antibody; PADI2 antibody - middle region; anti-PADI2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYV
Sequence Length
665
Applicable Applications for anti-PADI2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PADI2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: PADI2Sample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA200242_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: PADI2Sample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PADI2Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200242_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PADI2Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PADI2Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200242_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: PADI2Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-PADI2 antibody
This is a rabbit polyclonal antibody against PADI2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PADI2 encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. PADI2 is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis.This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis. This gene exists in a cluster with four other paralogous genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-PADI2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
protein-arginine deiminase type-2
NCBI Official Synonym Full Names
peptidyl arginine deiminase 2
NCBI Official Symbol
PADI2
NCBI Official Synonym Symbols
PAD2; PDI2; PAD-H19
NCBI Protein Information
protein-arginine deiminase type-2
UniProt Protein Name
Protein-arginine deiminase type-2
UniProt Gene Name
PADI2
UniProt Synonym Gene Names
KIAA0994; PDI2
UniProt Entry Name
PADI2_HUMAN

Similar Products

Product Notes

The PADI2 padi2 (Catalog #AAA200242) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PADI2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PADI2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PADI2 padi2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RGDRWIQDEI EFGYIEAPHK GFPVVLDSPR DGNLKDFPVK ELLGPDFGYV. It is sometimes possible for the material contained within the vial of "PADI2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.