WB (Western Blot)
(Host: RabbitTarget Name: PADI4Sample Type: 721_B Cell lysatesAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PADI4 is expressed in 721_B)
Rabbit PADI4 Polyclonal Antibody | anti-PADI4 antibody
PADI4 antibody - middle region
Gene Names
PADI4; PAD; PAD4; PDI4; PDI5; PADI5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PADI4, Antibody; PADI4 antibody - middle region; anti-PADI4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL
Sequence Length
663
Applicable Applications for anti-PADI4 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 87%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%; Sheep: 79%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PADI4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget Name: PADI4Sample Type: 721_B Cell lysatesAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PADI4 is expressed in 721_B)
WB (Western Blot)
(Host: RabbitTarget Name: PADI4Sample Type: 721_B Cell lysatesAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PADI4 is expressed in 721_B)
WB (Western Blot)
(Host: RabbitTarget Name: PADI4Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: PADI4Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-PADI4 antibody
This is a rabbit polyclonal antibody against PADI4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-PADI4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
protein-arginine deiminase type-4
NCBI Official Synonym Full Names
peptidyl arginine deiminase 4
NCBI Official Symbol
PADI4
NCBI Official Synonym Symbols
PAD; PAD4; PDI4; PDI5; PADI5
NCBI Protein Information
protein-arginine deiminase type-4
UniProt Protein Name
Protein-arginine deiminase type-4
UniProt Gene Name
PADI4
UniProt Synonym Gene Names
PADI5; PDI5
UniProt Entry Name
PADI4_HUMAN
Similar Products
Product Notes
The PADI4 padi4 (Catalog #AAA200439) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PADI4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PADI4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PADI4 padi4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TGGISGLDSF GNLEVSPPVT VRGKEYPLGR ILFGDSCYPS NDSRQMHQAL. It is sometimes possible for the material contained within the vial of "PADI4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.