Rabbit Pannexin 2 Polyclonal Antibody | anti-LOC100533356 antibody
Pannexin 2 antibody
Reactivity
Human, Mouse, Rat, Dog, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
Pannexin 2, Antibody; Pannexin 2 antibody; Polyclonal Pannexin 2; Anti-Pannexin 2; Pannexin 2; Pannexin -2; hPANX2; PANX2; anti-LOC100533356 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog, Zebrafish
Clonality
Polyclonal
Specificity
Pannexin 2 antibody was raised against the N terminal of PANX2
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PANX2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
416
Applicable Applications for anti-LOC100533356 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
PANX2 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties.
Cross-Reactivity
Human, Mouse, Rat, Dog, ZebraFish
Immunogen
Pannexin 2 antibody was raised using the N terminal of PANX2 corresponding to a region with amino acids GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-LOC100533356 antibody
Rabbit polyclonal Pannexin 2 antibody raised against the N terminal of PANX2
Product Categories/Family for anti-LOC100533356 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
70 kDa (MW of target protein)
NCBI Official Full Name
pannexin 2
NCBI Official Symbol
LOC100533356
NCBI Protein Information
pannexin 2
Similar Products
Product Notes
The LOC100533356 (Catalog #AAA224235) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Pannexin 2 antibody reacts with Human, Mouse, Rat, Dog, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Pannexin 2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the LOC100533356 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Pannexin 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
