Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199939_WB8.jpg WB (Western Blot) (WB Suggested Anti-PAPSS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Rabbit PAPSS2 Polyclonal Antibody | anti-PAPSS2 antibody

PAPSS2 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
PAPSS2; SK2; BCYM4; ATPSK2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PAPSS2, Antibody; PAPSS2 antibody - C-terminal region; anti-PAPSS2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN
Sequence Length
619
Applicable Applications for anti-PAPSS2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PAPSS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PAPSS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

product-image-AAA199939_WB8.jpg WB (Western Blot) (WB Suggested Anti-PAPSS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: PAPSS2Sample Type: Human HelaAntibody Dilution: 1.0ug/mlPAPSS2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

product-image-AAA199939_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: PAPSS2Sample Type: Human HelaAntibody Dilution: 1.0ug/mlPAPSS2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

WB (Western Blot)

(Host: RabbitTarget Name: PAPSS2Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PAPSS2 is expressed in 721_B)

product-image-AAA199939_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: PAPSS2Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PAPSS2 is expressed in 721_B)

IHC (Immunohiostchemistry)

(PAPSS2 antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199939_IHC13.jpg IHC (Immunohiostchemistry) (PAPSS2 antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(PAPSS2 antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199939_IHC15.jpg IHC (Immunohistochemistry) (PAPSS2 antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-PAPSS2 antibody
This is a rabbit polyclonal antibody against PAPSS2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. PAPSS2 is one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.
Product Categories/Family for anti-PAPSS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 isoform b
NCBI Official Synonym Full Names
3'-phosphoadenosine 5'-phosphosulfate synthase 2
NCBI Official Symbol
PAPSS2
NCBI Official Synonym Symbols
SK2; BCYM4; ATPSK2
NCBI Protein Information
bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
UniProt Protein Name
Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
UniProt Gene Name
PAPSS2
UniProt Synonym Gene Names
ATPSK2; PAPS synthase 2; PAPSS 2; SK 2; SK2; SAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PAPSS2 papss2 (Catalog #AAA199939) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAPSS2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PAPSS2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PAPSS2 papss2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PARHNEFDFI SGTRMRKLAR EGENPPDGFM APKAWKVLTD YYRSLEKN. It is sometimes possible for the material contained within the vial of "PAPSS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.