Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199195_WB13.jpg WB (Western Blot) (WB Suggested Anti-PARD3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Thymus)

Rabbit PARD3 Polyclonal Antibody | anti-PARD3 antibody

PARD3 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
PARD3; Baz; ASIP; PAR3; PARD-3; PARD3A; SE2-5T2; PPP1R118; SE2-5L16; SE2-5LT1; PAR3alpha
Reactivity
Guinea Pig, Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PARD3, Antibody; PARD3 antibody - middle region; anti-PARD3 antibody
Ordering
Host
Rabbit
Reactivity
Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNR
Sequence Length
1356
Applicable Applications for anti-PARD3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Guinea Pig: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PARD3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PARD3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Thymus)

product-image-AAA199195_WB13.jpg WB (Western Blot) (WB Suggested Anti-PARD3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Thymus)

IHC (Immunohistochemistry)

(Rabbit Anti-PARD3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199195_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-PARD3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-PARD3 antibody
This is a rabbit polyclonal antibody against PARD3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PARD proteins, which were first identified in C. elegans, are essential for asymmetric cell division and polarized growth, whereas CDC42 (MIM 116952) mediates the establishment of cell polarity. The CDC42 GTPase, which is controlled by nucleotide exchange

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
151kDa
NCBI Official Full Name
partitioning defective 3 homolog isoform 2
NCBI Official Synonym Full Names
par-3 family cell polarity regulator
NCBI Official Symbol
PARD3
NCBI Official Synonym Symbols
Baz; ASIP; PAR3; PARD-3; PARD3A; SE2-5T2; PPP1R118; SE2-5L16; SE2-5LT1; PAR3alpha
NCBI Protein Information
partitioning defective 3 homolog
UniProt Protein Name
Partitioning defective 3 homolog
UniProt Gene Name
PARD3
UniProt Synonym Gene Names
PAR3; PAR3A; PAR-3; PARD-3; ASIP
UniProt Entry Name
PARD3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PARD3 pard3 (Catalog #AAA199195) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PARD3 antibody - middle region reacts with Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's PARD3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PARD3 pard3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EQQMKKQPPS EGPSNYDSYK KVQDPSYAPP KGPFRQDVPP SPSQVARLNR. It is sometimes possible for the material contained within the vial of "PARD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.