Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199189_WB13.jpg WB (Western Blot) (WB Suggested Anti-PARD6A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

Rabbit PARD6A Polyclonal Antibody | anti-PARD6A antibody

PARD6A antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
PARD6A; PAR6; PAR6C; TAX40; PAR-6A; TIP-40; PAR6alpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PARD6A, Antibody; PARD6A antibody - N-terminal region; anti-PARD6A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH
Sequence Length
345
Applicable Applications for anti-PARD6A antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PARD6A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PARD6A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

product-image-AAA199189_WB13.jpg WB (Western Blot) (WB Suggested Anti-PARD6A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

WB (Western Blot)

(Host: MouseTarget Name: PARD6ASample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

product-image-AAA199189_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: PARD6ASample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)
Related Product Information for anti-PARD6A antibody
This is a rabbit polyclonal antibody against PARD6A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product Categories/Family for anti-PARD6A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
partitioning defective 6 homolog alpha isoform 2
NCBI Official Synonym Full Names
par-6 family cell polarity regulator alpha
NCBI Official Symbol
PARD6A
NCBI Official Synonym Symbols
PAR6; PAR6C; TAX40; PAR-6A; TIP-40; PAR6alpha
NCBI Protein Information
partitioning defective 6 homolog alpha

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PARD6A (Catalog #AAA199189) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PARD6A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PARD6A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PARD6A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MARPQRTPAR SPDSIVEVKS KFDAEFRRFA LPRASVSGFQ EFSRLLRAVH. It is sometimes possible for the material contained within the vial of "PARD6A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.