Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200144_WB11.jpg WB (Western Blot) (WB Suggested Anti-PARK7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit PARK7 Polyclonal Antibody | anti-PARK7 antibody

PARK7 antibody - C-terminal region

Gene Names
PARK7; DJ1; DJ-1; GATD2; HEL-S-67p
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PARK7, Antibody; PARK7 antibody - C-terminal region; anti-PARK7 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD
Sequence Length
189
Applicable Applications for anti-PARK7 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PARK7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PARK7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

product-image-AAA200144_WB11.jpg WB (Western Blot) (WB Suggested Anti-PARK7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(PARK7 antibody - C-terminal region validated by WB using SH-SY5Y cell line at 1: 500.PARK7 is supported by BioGPS gene expression data to be expressed in SHSY5Y)

product-image-AAA200144_WB13.jpg WB (Western Blot) (PARK7 antibody - C-terminal region validated by WB using SH-SY5Y cell line at 1: 500.PARK7 is supported by BioGPS gene expression data to be expressed in SHSY5Y)

IHC (Immunohistochemistry)

(Sample Type: Mouse brainSample Type: Mouse Brain Slices Red: primaryBlue: DAPIPrimaryDilution: 1:400 Secondary Antibody: Anti-Rabbit IgG Alexa 594SecondaryDilution: 1:400 Image Submitted By: Adahir Labrador-Garrido and Cintia RoodveldtUniversity of Seville)

product-image-AAA200144_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Mouse brainSample Type: Mouse Brain Slices Red: primaryBlue: DAPIPrimaryDilution: 1:400 Secondary Antibody: Anti-Rabbit IgG Alexa 594SecondaryDilution: 1:400 Image Submitted By: Adahir Labrador-Garrido and Cintia RoodveldtUniversity of Seville)
Related Product Information for anti-PARK7 antibody
This is a rabbit polyclonal antibody against PARK7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PARK7 belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7.The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
protein/nucleic acid deglycase DJ-1
NCBI Official Synonym Full Names
Parkinsonism associated deglycase
NCBI Official Symbol
PARK7
NCBI Official Synonym Symbols
DJ1; DJ-1; GATD2; HEL-S-67p
NCBI Protein Information
protein/nucleic acid deglycase DJ-1
UniProt Protein Name
Protein DJ-1
UniProt Gene Name
PARK7
UniProt Entry Name
PARK7_HUMAN

Similar Products

Product Notes

The PARK7 park7 (Catalog #AAA200144) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PARK7 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PARK7 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PARK7 park7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TYSENRVEKD GLILTSRGPG TSFEFALAIV EALNGKEVAA QVKAPLVLKD. It is sometimes possible for the material contained within the vial of "PARK7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.