Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46445_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Parvin alpha Picoband antibody, AAA46445, IHC(P)IHC(P): Human Mammary Cancer Tissue)

Parvin alpha Polyclonal Antibody | anti-PARVA antibody

Anti-Parvin alpha Antibody

Gene Names
PARVA; MXRA2; CH-ILKBP
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Parvin alpha, Antibody; Anti-Parvin alpha Antibody; Alpha-parvin; Actopaxin; Alpha parvin; Calponin like integrin linked kinase binding protein; Calponin-like integrin-linked kinase-binding protein; CH ILKBP; CH-ILKBP; FLJ10793; FLJ12254; Matrix remodelling associated 2; Matrix remodelling associated protein 2; Matrix-remodeling-associated protein 2; MXRA 2; MXRA2; PARV A; PARVA; PARVA_HUMAN; parvin, alpha; anti-PARVA antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
412
Applicable Applications for anti-PARVA antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Parvin alpha (155-185aa QKLQTVLEKINETLKLPPRSIKWNVDSVHAK), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti- Parvin alpha Picoband antibody, AAA46445, IHC(P)IHC(P): Human Mammary Cancer Tissue)

product-image-AAA46445_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Parvin alpha Picoband antibody, AAA46445, IHC(P)IHC(P): Human Mammary Cancer Tissue)

WB (Western Blot)

(Anti- Parvin alpha Picoband antibody, AAA46445, Western blottingAll lanes: Anti Parvin alpha (AAA46445) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: SW620 Whole Cell Lysate at 40ugLane 4: HEPA Whole Cell Lysate at 40ugPredicted bind size: 42KDObserved bind size: 42KD)

product-image-AAA46445_WB15.jpg WB (Western Blot) (Anti- Parvin alpha Picoband antibody, AAA46445, Western blottingAll lanes: Anti Parvin alpha (AAA46445) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: SW620 Whole Cell Lysate at 40ugLane 4: HEPA Whole Cell Lysate at 40ugPredicted bind size: 42KDObserved bind size: 42KD)
Related Product Information for anti-PARVA antibody
Description: Rabbit IgG polyclonal antibody for Alpha-parvin(PARVA) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Parvin alpha is a protein that in humans is encoded by the PARVA gene. It is located on 11p15.3. PARVA belongs to the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival.
References
1. "Entrez Gene: PARVA parvin, alpha". 2. Olski TM, Noegel AA, Korenbaum E (Feb 2001). "Parvin, a 42 kDa focal adhesion protein, related to the alpha-actinin superfamily". J Cell Sci 114 (Pt 3): 525-38. 3. Zhang Y, Chen K, Tu Y, Wu C (2004). "Distinct roles of two structurally closely related focal adhesion proteins, alpha-parvins and beta-parvins, in regulation of cell morphology and survival.". J. Biol. Chem. 279 (40): 41695-705.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,625 Da
NCBI Official Full Name
alpha-parvin
NCBI Official Synonym Full Names
parvin alpha
NCBI Official Symbol
PARVA
NCBI Official Synonym Symbols
MXRA2; CH-ILKBP
NCBI Protein Information
alpha-parvin
UniProt Protein Name
Alpha-parvin
UniProt Gene Name
PARVA
UniProt Synonym Gene Names
MXRA2
UniProt Entry Name
PARVA_HUMAN

Similar Products

Product Notes

The PARVA parva (Catalog #AAA46445) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Parvin alpha Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Parvin alpha can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PARVA parva for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Parvin alpha, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.