Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198440_WB13.jpg WB (Western Blot) (WB Suggested Anti-PATZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysatePATZ1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit PATZ1 Polyclonal Antibody | anti-PATZ1 antibody

PATZ1 antibody - middle region

Gene Names
PATZ1; ZSG; MAZR; PATZ; RIAZ; ZBTB19; ZNF278; dJ400N23
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PATZ1, Antibody; PATZ1 antibody - middle region; anti-PATZ1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SFFRSKSYLNKHIQKVHVRALGGPLGDLGPALGSPFSPQQNMSLLESFGF
Sequence Length
687
Applicable Applications for anti-PATZ1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PATZ1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PATZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysatePATZ1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

product-image-AAA198440_WB13.jpg WB (Western Blot) (WB Suggested Anti-PATZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysatePATZ1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

IHC (Immunohistochemistry)

(Rabbit Anti-PATZ1 antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: alveolar cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198440_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-PATZ1 antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: alveolar cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-PATZ1 antibody
This is a rabbit polyclonal antibody against PATZ1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PATZ1 contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction and is required for transcriptional repression, and the zinc-fingers comprise the DNA binding domain. Since the encoded protein has typical features of a transcription factor, it is postulated to be a repressor of gene expression. In small round cell sarcoma, this gene is fused to EWS by a small inversion of 22q, then the hybrid is thought to be translocated (t(1;22)(p36.1;q12).The protein encoded by this gene contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction and is required for transcriptional repression, and the zinc-fingers comprise the DNA binding domain. Since the encoded protein has typical features of a transcription factor, it is postulated to be a repressor of gene expression. In small round cell sarcoma, this gene is fused to EWS by a small inversion of 22q, then the hybrid is thought to be translocated (t(1;22)(p36.1;q12). The rearrangement of chromosome 22 involves intron 8 of EWS and exon 1 of this gene creating a chimeric sequence containing the transactivation domain of EWS fused to zinc finger domain of this protein. This is a distinct example of an intra-chromosomal rearrangement of chromosome 22. Four alternatively spliced transcript variants are described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
POZ-, AT hook-, and zinc finger-containing protein 1 long C isoform
NCBI Official Synonym Full Names
POZ/BTB and AT hook containing zinc finger 1
NCBI Official Symbol
PATZ1
NCBI Official Synonym Symbols
ZSG; MAZR; PATZ; RIAZ; ZBTB19; ZNF278; dJ400N23
NCBI Protein Information
POZ-, AT hook-, and zinc finger-containing protein 1
UniProt Protein Name
POZ-, AT hook-, and zinc finger-containing protein 1
UniProt Gene Name
PATZ1
UniProt Synonym Gene Names
PATZ; RIAZ; ZBTB19; ZNF278; ZSG
UniProt Entry Name
PATZ1_HUMAN

Similar Products

Product Notes

The PATZ1 patz1 (Catalog #AAA198440) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PATZ1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PATZ1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PATZ1 patz1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SFFRSKSYLN KHIQKVHVRA LGGPLGDLGP ALGSPFSPQQ NMSLLESFGF. It is sometimes possible for the material contained within the vial of "PATZ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.