<
SDS-PAGE
(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. A second isoform of 33 kDa also contains the peptide, and the protein is phosphorylated.)
Rabbit PCBP1 Polyclonal Antibody | anti-PCBP1 antibody
PCBP1 Antibody - middle region
Gene Names
PCBP1; HNRPX; HNRPE1; hnRNP-X; HEL-S-85; hnRNP-E1
Reactivity
Tested Species Reactivity: Human, MousePredicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PCBP1, Antibody; PCBP1 Antibody - middle region; anti-PCBP1 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human, Mouse
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% sodium azide.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF
Sequence Length
356
Applicable Applications for anti-PCBP1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
QC Western Blot : Pass
IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human PCBP1
Protein Size (# AA)
356 amino acids
Protein Interactions
HUWE1; UBC; SNRPA; TP53; SUMO2; SUMO3; TUBGCP3; STAU1; ERG; EED; TUBB6; TUBB2A; PFKP; PFKM; SRPK2; SRPK1; SRPK3; FBXO6; TARDBP; UBD; ADRB2; NPM1; LMNA; HMGA1; CD81; PAN2; PRPF8; PPIG; PRPF3; UBL4A; ANP32A; VCAM1; NOS2; ITGA4; FN1; ATF2; ZNF830; ZCCHC10; P
Enhanced Validation
Relative Expression (Western Blot)
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
SDS-PAGE
(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. A second isoform of 33 kDa also contains the peptide, and the protein is phosphorylated.)
SDS-PAGE
(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. A second isoform of 33 kDa also contains the peptide, and the protein is phosphorylated.)
WB (Western Blot)
(Host: RabbitTarget Name: PCBP1Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/mlPCBP1 is supported by BioGPS gene expression data to be expressed in MCF7)
WB (Western Blot)
(Host: RabbitTarget Name: PCBP1Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/mlPCBP1 is supported by BioGPS gene expression data to be expressed in MCF7)
WB (Western Blot)
(Host: RabbitTarget Name: PCBP1Sample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: PCBP1Sample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: PCBP1Sample Tissue: Human HCT116Antibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: PCBP1Sample Tissue: Human HCT116Antibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: PCBP1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: PCBP1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
IHC (Immunohistochemistry)
(Rabbit Anti-PCBP1 AntibodyParaffin Embedded Tissue: Human BreastAntibody Concentration: 5 ug/ml)
IHC (Immunohistochemistry)
(Rabbit Anti-PCBP1 AntibodyParaffin Embedded Tissue: Human BreastAntibody Concentration: 5 ug/ml)
IHC (Immunohistochemistry)
(Rabbit Anti-PCBP1 AntibodyParaffin Embedded Tissue: Human BreastAntibody Concentration: 5 ug/ml)
IHC (Immunohistochemistry)
(Rabbit Anti-PCBP1 AntibodyParaffin Embedded Tissue: Human BreastAntibody Concentration: 5 ug/ml)
IHC (Immunohistochemistry)
(Sample Type: Human spleenAnti-PCBP1 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
IHC (Immunohistochemistry)
(Sample Type: Human spleenAnti-PCBP1 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
Related Product Information for anti-PCBP1 antibody
This is a rabbit polyclonal antibody against PCBP1. It was validated on Western Blot
Target Description: PCBP1 appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. PCBP1 is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.This intronless gene is thought to be generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.
Target Description: PCBP1 appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. PCBP1 is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.This intronless gene is thought to be generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.
Product Categories/Family for anti-PCBP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
poly(rC)-binding protein 1
NCBI Official Synonym Full Names
poly(rC) binding protein 1
NCBI Official Symbol
PCBP1
NCBI Official Synonym Symbols
HNRPX; HNRPE1; hnRNP-X; HEL-S-85; hnRNP-E1
NCBI Protein Information
poly(rC)-binding protein 1
UniProt Protein Name
Poly(rC)-binding protein 1
UniProt Gene Name
PCBP1
UniProt Synonym Gene Names
hnRNP E1
UniProt Entry Name
PCBP1_HUMAN
Similar Products
Product Notes
The PCBP1 pcbp1 (Catalog #AAA23480) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCBP1 Antibody - middle region reacts with Tested Species Reactivity: Human, Mouse Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's PCBP1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). QC Western Blot : Pass IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE). Researchers should empirically determine the suitability of the PCBP1 pcbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PHATHDLEGP PLDAYSIQGQ HTISPLDLAK LNQVARQQSH FAMMHGGTGF. It is sometimes possible for the material contained within the vial of "PCBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.