WB (Western Blot)
(WB Suggested Anti-PCDHGC4 Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysate)
Rabbit PCDHGC4 Polyclonal Antibody | anti-PCDHGC4 antibody
PCDHGC4 antibody - N-terminal region
Gene Names
PCDHGC4; PCDH-GAMMA-C4
Reactivity
Tested: HumanPredicted: Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PCDHGC4, Antibody; PCDHGC4 antibody - N-terminal region; anti-PCDHGC4 antibody
Host
Rabbit
Reactivity
Tested: Human
Predicted: Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted: Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Applicable Applications for anti-PCDHGC4 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Protein Size (# AA)
938 amino acids
Peptide Sequence
Synthetic peptide located within the following region: VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVS
Blocking Peptide
For anti-PCDHGC4 (MBS3209429) antibody is Catalog#
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PCDHGC4
Predicted Homology Based on Immunogen Sequence
Horse: 100%; Human: 100%; Mouse: 100%; Pig: 91%; Rabbit: 79%; Rat: 100%; Zebrafish: 100%
Replacement Item
This antibody may replace item sc-106954 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PCDHGC4 Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysate)
WB (Western Blot)
(WB Suggested Anti-PCDHGC4 Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysate)
IHC (Immunohistochemistry)
(PCDHGC4 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(PCDHGC4 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-PCDHGC4 antibody
PCDHGC4 is a single-pass type I membrane protein. It contains 6 cadherin domains.PCDHGC4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.
Product Categories/Family for anti-PCDHGC4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
protocadherin gamma-C4 isoform 1
NCBI Official Synonym Full Names
protocadherin gamma subfamily C, 4
NCBI Official Symbol
PCDHGC4
NCBI Official Synonym Symbols
PCDH-GAMMA-C4
NCBI Protein Information
protocadherin gamma-C4
UniProt Protein Name
Protocadherin gamma-C4
UniProt Gene Name
PCDHGC4
UniProt Synonym Gene Names
PCDH-gamma-C4
Similar Products
Product Notes
The PCDHGC4 pcdhgc4 (Catalog #AAA199990) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCDHGC4 antibody - N-terminal region reacts with Tested: Human Predicted: Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PCDHGC4 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PCDHGC4 pcdhgc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCDHGC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.