Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282259_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using PDCD1LG2 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit PDCD1LG2 Polyclonal Antibody | anti-PDCD1LG2 antibody

PDCD1LG2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
CDK2AP1; DOC1; ST19; DORC1; doc-1; p12DOC-1
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
PDCD1LG2, Antibody; PDCD1LG2 Rabbit pAb; B7DC; Btdc; CD273; PD-L2; PDCD1L2; PDL2; bA574F11.2; PDCD1LG2; anti-PDCD1LG2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Applicable Applications for anti-PDCD1LG2 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Positive Samples
Rat spleen, Rat thymus
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human PDCD1LG2 (NP_079515.2).
Cellular Location
external side of plasma membrane, extracellular region, plasma membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using PDCD1LG2 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282259_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using PDCD1LG2 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HepG2 cells using PDCD1LG2 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282259_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HepG2 cells using PDCD1LG2 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using PDCD1LG2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)

product-image-AAA282259_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using PDCD1LG2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)
Related Product Information for anti-PDCD1LG2 antibody
Programmed Death Ligand 2 (PD-L2), also known as B7-DC and butyrophilin-like protein, is a member of the B7 family of proteins that provide signals for regulating T-cell activation and tolerance.PD-L2 is expressed on dendritic cells, subsets of activated CD4+ and CD8+ T cells, and memory B cells that differentiate into plasma cells. At inflammatory sites such as rheumatoid arthritis, allergen exposure, and virus infection, PD-L2 is up-regulated on synoviocytes, infiltrating macrophages, dendritic cells, and airway epithelial cells. PD-L2, along with B7-H1/PD-L1, binds to T cell PD-1 where it promotes IFN-gamma production and CD40 Ligand up-regulation while inhibiting IL-4 production. In addition, PD-L2 binds to RGM-B on macrophages and alveolar epithelial cells, supporting respiratory immune tolerance. In asthma, PD-L2 suppresses IL-5 and IL-13 production, promotes IL-12 production by dendritic cells, and supports allergen-induced airway hyper-responsiveness and mucus production.
Product Categories/Family for anti-PDCD1LG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,365 Da
NCBI Official Full Name
cyclin-dependent kinase 2-associated protein 1 isoform 2
NCBI Official Synonym Full Names
cyclin-dependent kinase 2 associated protein 1
NCBI Official Symbol
CDK2AP1
NCBI Official Synonym Symbols
DOC1; ST19; DORC1; doc-1; p12DOC-1
NCBI Protein Information
cyclin-dependent kinase 2-associated protein 1; Deleted in oral cancer-1; deleted in oral cancer 1; CDK2-associated protein 1; putative oral cancer suppressor
UniProt Protein Name
Cyclin-dependent kinase 2-associated protein 1
UniProt Gene Name
CDK2AP1
UniProt Synonym Gene Names
CDKAP1; DOC1; CDK2-associated protein 1; DOC-1
UniProt Entry Name
CDKA1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PDCD1LG2 cdk2ap1 (Catalog #AAA282259) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDCD1LG2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDCD1LG2 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the PDCD1LG2 cdk2ap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSYKPNLAAH MPAAALNAAG SVHSPSTSMA TSSQYRQLLS DYGPPSLGYT QGTGNSQVPQ SKYAELLAII EELGKEIRPT YAGSKSAMER LKRGIIHARG LVRECLAETE RNARS. It is sometimes possible for the material contained within the vial of "PDCD1LG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.