Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200642_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: PDE4DSample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit PDE4D Polyclonal Antibody | anti-PDE4D antibody

PDE4D Antibody - C-terminal region

Gene Names
PDE4D; DPDE3; PDE43; STRK1; ACRDYS2; HSPDE4D; PDE4DN2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDE4D, Antibody; PDE4D Antibody - C-terminal region; anti-PDE4D antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQ
Sequence Length
507
Applicable Applications for anti-PDE4D antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDE4D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: PDE4DSample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA200642_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: PDE4DSample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PDE4DSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA200642_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PDE4DSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: PDE4DSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA200642_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: PDE4DSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Related Product Information for anti-PDE4D antibody
This is a rabbit polyclonal antibody against PDE4D. It was validated on Western Blot

Target Description: This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses different promoters to generate multiple alternatively spliced transcript variants that encode functional proteins.
Product Categories/Family for anti-PDE4D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
PDE4D protein
NCBI Official Synonym Full Names
phosphodiesterase 4D
NCBI Official Symbol
PDE4D
NCBI Official Synonym Symbols
DPDE3; PDE43; STRK1; ACRDYS2; HSPDE4D; PDE4DN2
NCBI Protein Information
cAMP-specific 3',5'-cyclic phosphodiesterase 4D
UniProt Protein Name
cAMP-specific 3',5'-cyclic phosphodiesterase 4D
UniProt Gene Name
PDE4D
UniProt Synonym Gene Names
DPDE3
UniProt Entry Name
PDE4D_HUMAN

Similar Products

Product Notes

The PDE4D pde4d (Catalog #AAA200642) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDE4D Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PDE4D can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PDE4D pde4d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FQFELTLEED GESDTEKDSG SQVEEDTSCS DSKTLCTQDS ESTEIPLDEQ. It is sometimes possible for the material contained within the vial of "PDE4D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.