Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201115_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PDGFCSample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit PDGFC Polyclonal Antibody | anti-PDGFC antibody

PDGFC Antibody - C-terminal region

Gene Names
PDGFC; SCDGF; FALLOTEIN
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDGFC, Antibody; PDGFC Antibody - C-terminal region; anti-PDGFC antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS
Sequence Length
190
Applicable Applications for anti-PDGFC antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human PDGFC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: PDGFCSample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201115_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PDGFCSample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: PDGFCSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA201115_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: PDGFCSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)
Related Product Information for anti-PDGFC antibody
This is a rabbit polyclonal antibody against PDGFC. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines. This gene product appears to form only homodimers. It differs from the platelet-derived growth factor alpha and beta polypeptides in having an unusual N-terminal domain, the CUB domain. Alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for anti-PDGFC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
platelet-derived growth factor C
NCBI Official Synonym Full Names
platelet derived growth factor C
NCBI Official Symbol
PDGFC
NCBI Official Synonym Symbols
SCDGF; FALLOTEIN
NCBI Protein Information
platelet-derived growth factor C
UniProt Protein Name
Platelet-derived growth factor C
UniProt Gene Name
PDGFC
UniProt Synonym Gene Names
SCDGF; PDGF-C; SCDGF; PDGFC latent form
UniProt Entry Name
PDGFC_HUMAN

Similar Products

Product Notes

The PDGFC pdgfc (Catalog #AAA201115) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDGFC Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PDGFC can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PDGFC pdgfc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CTPRNFSVSI REELKRTDTI FWPGCLLVKR CGGNCACCLH NCNECQCVPS. It is sometimes possible for the material contained within the vial of "PDGFC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.