Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199866_WB13.jpg WB (Western Blot) (WB Suggested Anti-PDHA1 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysatePDHA1 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit PDHA1 Polyclonal Antibody | anti-PDHA1 antibody

PDHA1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
PDHA1; PDHA; PDHAD; PHE1A; PDHCE1A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
PDHA1, Antibody; PDHA1 antibody - N-terminal region; anti-PDHA1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP
Sequence Length
390
Applicable Applications for anti-PDHA1 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PDHA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PDHA1 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysatePDHA1 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA199866_WB13.jpg WB (Western Blot) (WB Suggested Anti-PDHA1 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysatePDHA1 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(WB Suggested Anti-PDHA1 AntibodyPositive Control: Lane 1: 80ug mouse brain extractPrimary Antibody Dilution : 1:500Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR BioscienceSecondry Antibody Dilution : 1:20,000Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA199866_WB15.jpg WB (Western Blot) (WB Suggested Anti-PDHA1 AntibodyPositive Control: Lane 1: 80ug mouse brain extractPrimary Antibody Dilution : 1:500Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR BioscienceSecondry Antibody Dilution : 1:20,000Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Related Product Information for anti-PDHA1 antibody
This is a rabbit polyclonal antibody against PDHA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The pyruvate dehydrogenase complex is a nuclear-encoded mitochondrial matrix multienzyme complex that provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle by catalyzing the irreversible conversion of pyruvate into acetyl-CoA. The PDH complex is composed of multiple copies of 3 enzymes: E1 (PDHA1); dihydrolipoyl transacetylase (DLAT); and dihydrolipoyl dehydrogenase (DLD). The E1 enzyme is a heterotetramer of 2 alpha and 2 beta subunits. The E1-alpha subunit contains the E1 active site and plays a key role in the function of the PDH complex.The pyruvate dehydrogenase complex is a nuclear-encoded mitochondrial matrix multienzyme complex that provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle by catalyzing the irreversible conversion of pyruvate into acetyl-CoA. The PDH complex is composed of multiple copies of 3 enzymes: E1 (PDHA1); dihydrolipoyl transacetylase (DLAT; MIM 608770) (E2; EC 2.3.1.12); and dihydrolipoyl dehydrogenase (DLD; MIM 238331) (E3; EC 1.8.1.4). The E1 enzyme is a heterotetramer of 2 alpha and 2 beta subunits. The E1-alpha subunit contains the E1 active site and plays a key role in the function of the PDH complex (Brown et al., 1994 [PubMed 7853374]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-PDHA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial isoform 1
NCBI Official Synonym Full Names
pyruvate dehydrogenase E1 alpha 1 subunit
NCBI Official Symbol
PDHA1
NCBI Official Synonym Symbols
PDHA; PDHAD; PHE1A; PDHCE1A
NCBI Protein Information
pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
UniProt Protein Name
Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
UniProt Gene Name
PDHA1
UniProt Synonym Gene Names
PHE1A
UniProt Entry Name
ODPA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PDHA1 pdha1 (Catalog #AAA199866) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDHA1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDHA1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PDHA1 pdha1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MRKMLAAVSR VLSGASQKPA SRVLVASRNF ANDATFEIKK CDLHRLEEGP. It is sometimes possible for the material contained within the vial of "PDHA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.