Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA23546_WB7.jpg WB (Western Blot) (WB Suggested Anti-PDIA6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate.PDIA6 is strongly supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit PDIA6 Polyclonal Antibody | anti-PDIA6 antibody

PDIA6 antibody - middle region

Gene Names
PDIA6; P5; ERP5; TXNDC7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PDIA6, Antibody; PDIA6 antibody - middle region; anti-PDIA6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRA
Sequence Length
440
Applicable Applications for anti-PDIA6 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PDIA6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PDIA6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate.PDIA6 is strongly supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA23546_WB7.jpg WB (Western Blot) (WB Suggested Anti-PDIA6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate.PDIA6 is strongly supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: PDIA6Sample Type: MCF7Antibody Dilution: 1.0ug/mlPDIA6 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA23546_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: PDIA6Sample Type: MCF7Antibody Dilution: 1.0ug/mlPDIA6 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: PDIA6Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23546_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: PDIA6Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PDIA6Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23546_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: PDIA6Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PDIA6Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23546_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: PDIA6Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PDIA6Sample Type: 721_BAntibody Dilution: 1.0ug/mlPDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA23546_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: PDIA6Sample Type: 721_BAntibody Dilution: 1.0ug/mlPDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

IHC (Immunohistochemistry)

(Immunohistochemistry with Small intestine tissue)

product-image-AAA23546_IHC.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Small intestine tissue)
Related Product Information for anti-PDIA6 antibody
This is a rabbit polyclonal antibody against PDIA6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.Protein disulfide isomerases (EC 5.3.4.1), such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins (Hayano and Kikuchi, 1995 [PubMed 7590364]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-39 BF979486.1 11-49 40-1858 BC001312.1 1-1819 1859-2326 AK127433.1 2215-2682 2327-2344 BM511594.1 1-18 c
Product Categories/Family for anti-PDIA6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
protein disulfide-isomerase A6 isoform d
NCBI Official Synonym Full Names
protein disulfide isomerase family A member 6
NCBI Official Symbol
PDIA6
NCBI Official Synonym Symbols
P5; ERP5; TXNDC7
NCBI Protein Information
protein disulfide-isomerase A6
UniProt Protein Name
Protein disulfide-isomerase A6
UniProt Gene Name
PDIA6
UniProt Synonym Gene Names
ERP5; P5; TXNDC7; ER protein 5; ERp5
UniProt Entry Name
PDIA6_HUMAN

Similar Products

Product Notes

The PDIA6 pdia6 (Catalog #AAA23546) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDIA6 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDIA6 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PDIA6 pdia6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KLAAVDATVN QVLASRYGIR GFPTIKIFQK GESPVDYDGG RTRSDIVSRA. It is sometimes possible for the material contained within the vial of "PDIA6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.