Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281212_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse pancreas using PDP2 antibody at dilution of 1:100 (40x lens).)

Rabbit PDP2 Polyclonal Antibody | anti-PDP2 antibody

PDP2 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
PDP2; PPM2B; PDPC 2; PPM2C2
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
PDP2, Antibody; PDP2 Polyclonal Antibody; PPM2B; PPM2C2; anti-PDP2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
STEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPL
Sequence Length
529
Applicable Applications for anti-PDP2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human PDP2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Mitochondrion matrix
Positive Samples
U-87MG, Jurkat, HeLa, Mouse kidney, Mouse liver, Rat liver
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded mouse pancreas using PDP2 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281212_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse pancreas using PDP2 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using PDP2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 15s.)

product-image-AAA281212_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using PDP2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 15s.)
Product Categories/Family for anti-PDP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 59kDa
Observed: 57kDa
NCBI Official Full Name
[Pyruvate dehydrogenase
NCBI Official Synonym Full Names
pyruvate dehyrogenase phosphatase catalytic subunit 2
NCBI Official Symbol
PDP2
NCBI Official Synonym Symbols
PPM2B; PDPC 2; PPM2C2
NCBI Protein Information
[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial; pyruvate dehydrogenase [acetyl-transferring]-phosphatase 2, mitochondrial
UniProt Protein Name
[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
UniProt Gene Name
PDP2
UniProt Synonym Gene Names
KIAA1348; PDP 2; PDPC 2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PDP2 pdp2 (Catalog #AAA281212) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDP2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDP2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PDP2 pdp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: STEEDDFHLQ LSPEQINEVL RAGETTHKIL DLESRVPNSV LRFESNQLAA NSPVEDRRGV ASCLQTNGLM FGIFDGHGGH ACAQAVSERL FYYVAVSLMS HQTLEHMEGA MESMKPLLPI LHWLKHPGDS IYKDVTSVHL DHLRVYWQEL LDLHMEMGLS IEEALMYSFQ RLDSDISLEI QAPL. It is sometimes possible for the material contained within the vial of "PDP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.