WB (Western Blot)
(WB Suggested Anti-PEA15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)
Rabbit PEA15 Polyclonal Antibody | anti-PEA15 antibody
PEA15 antibody - C-terminal region
Gene Names
PEA15; PED; MAT1; HMAT1; MAT1H; PEA-15; HUMMAT1H; PED-PEA15; PED/PEA15
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PEA15, Antibody; PEA15 antibody - C-terminal region; anti-PEA15 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
Sequence Length
130
Applicable Applications for anti-PEA15 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PEA15
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PEA15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)
WB (Western Blot)
(WB Suggested Anti-PEA15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)
WB (Western Blot)
(WB Suggested Anti-PEA15 AntibodyPositive Control: Lane 1: 20ug EGFP-transfected MCF7 lysate Lane 2: 20ug EGFP-PEA15 transfected MCF7 lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Goat anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Yann Wallez (Sanford-Burnham Medical Research Institute))
WB (Western Blot)
(WB Suggested Anti-PEA15 AntibodyPositive Control: Lane 1: 20ug EGFP-transfected MCF7 lysate Lane 2: 20ug EGFP-PEA15 transfected MCF7 lysatePrimary Antibody Dilution : 1:1000Secondary Antibody : Goat anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Yann Wallez (Sanford-Burnham Medical Research Institute))
IHC (Immunohistochemistry)
(Rabbit Anti-PEA15 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-PEA15 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-PEA15 antibody
This is a rabbit polyclonal antibody against PEA15. It was validated on Western Blot
Target Description: PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.
Target Description: PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.
Product Categories/Family for anti-PEA15 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
15kDa
NCBI Official Full Name
astrocytic phosphoprotein PEA-15 isoform b
NCBI Official Synonym Full Names
proliferation and apoptosis adaptor protein 15
NCBI Official Symbol
PEA15
NCBI Official Synonym Symbols
PED; MAT1; HMAT1; MAT1H; PEA-15; HUMMAT1H; PED-PEA15; PED/PEA15
NCBI Protein Information
astrocytic phosphoprotein PEA-15
UniProt Protein Name
Astrocytic phosphoprotein PEA-15
UniProt Gene Name
Pea15
UniProt Entry Name
PEA15_RAT
Similar Products
Product Notes
The PEA15 pea15 (Catalog #AAA200879) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PEA15 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PEA15 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PEA15 pea15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DYRTRVLKIS EEDELDTKLT RIPSAKKYKD IIRQPSEEEI IKLAPPPKKA. It is sometimes possible for the material contained within the vial of "PEA15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.