Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46653_IHC13.jpg IHC (Immunohiostchemistry) (Perilipin 3 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Perilipin 3 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit Perilipin 3 Polyclonal Antibody | anti-PLIN3 antibody

Anti-Perilipin 3 Antibody

Gene Names
PLIN3; PP17; TIP47; M6PRBP1
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
Perilipin 3, Antibody; Anti-Perilipin 3 Antibody; M6PRBP 1; M6PRBP1; Perilipin 3; Perilipin3; Perilipin-3; PLIN3; pp17; Placental protein 17; TIP47; O60664; perilipin 3; anti-PLIN3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
433
Applicable Applications for anti-PLIN3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Perilipin 3 (323-365aa ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQA RRQ), different from the related mouse sequence by fourteen amino acids.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Perilipin 3 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Perilipin 3 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46653_IHC13.jpg IHC (Immunohiostchemistry) (Perilipin 3 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Perilipin 3 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of Perilipin 3 expression in rat liver extract (lane 1), mouse kidney extract (lane 2) and HELA whole cell lysates (lane 3). Perilipin 3 at 47KD was detected using rabbit anti- Perilipin 3 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46653_WB15.jpg WB (Western Blot) (Western blot analysis of Perilipin 3 expression in rat liver extract (lane 1), mouse kidney extract (lane 2) and HELA whole cell lysates (lane 3). Perilipin 3 at 47KD was detected using rabbit anti- Perilipin 3 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-PLIN3 antibody
Rabbit IgG polyclonal antibody for Perilipin-3 (PLIN3) detection.
Background: Mannose-6-phosphate receptor binding protein 1 (M6PRBP1), also known as Perilipin 3 (PLN3) or TIP47, is a protein which in humans is encoded by the M6PRBP1 gene. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.
References
1. "Entrez Gene: M6PRBP1 mannose-6-phosphate receptor binding protein 1".
2. Bulankina AV, Deggerich A, Wenzel D, Mutenda K, Wittmann JG, Rudolph MG, Burger KN, Höning S (May 2009)."TIP47 functions in the biogenesis of lipid droplets". J. Cell Biol. 185 (4): 641-55.
3. Carroll KS, Hanna J, Simon I, Krise J, Barbero P, Pfeffer SR. (May 2001). "Role of Rab9 GTPase in facilitating receptor recruitment by TIP47.". Science 292(5520): 1373-6.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,803 Da
NCBI Official Full Name
perilipin-3 isoform 2
NCBI Official Synonym Full Names
perilipin 3
NCBI Official Symbol
PLIN3
NCBI Official Synonym Symbols
PP17; TIP47; M6PRBP1
NCBI Protein Information
perilipin-3
UniProt Protein Name
Perilipin-3
UniProt Gene Name
PLIN3
UniProt Synonym Gene Names
M6PRBP1; TIP47; 47 kDa MPR-binding protein; PP17
UniProt Entry Name
PLIN3_HUMAN

Similar Products

Product Notes

The PLIN3 plin3 (Catalog #AAA46653) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Perilipin 3 Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's Perilipin 3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PLIN3 plin3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Perilipin 3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.