WB (Western Blot)
(WB Suggested Anti-PFKL Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: human LCL and mouse brains)
Rabbit PFKL Polyclonal Antibody | anti-PFKL antibody
PFKL antibody - middle region
Gene Names
PFKL; PFK-B; PFK-L; ATP-PFK
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
PFKL, Antibody; PFKL antibody - middle region; anti-PFKL antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA
Sequence Length
568
Applicable Applications for anti-PFKL antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 79%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PFKL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PFKL Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: human LCL and mouse brains)
WB (Western Blot)
(WB Suggested Anti-PFKL Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: human LCL and mouse brains)
WB (Western Blot)
(WB Suggested Anti-PFKL Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysatePFKL is supported by BioGPS gene expression data to be expressed in HepG2)
WB (Western Blot)
(WB Suggested Anti-PFKL Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysatePFKL is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-PFKL antibody
This is a rabbit polyclonal antibody against PFKL. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit.
Target Description: Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit.
Product Categories/Family for anti-PFKL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
PFKL protein, partial
NCBI Official Synonym Full Names
phosphofructokinase, liver type
NCBI Official Symbol
PFKL
NCBI Official Synonym Symbols
PFK-B; PFK-L; ATP-PFK
NCBI Protein Information
ATP-dependent 6-phosphofructokinase, liver type
UniProt Protein Name
6-phosphofructokinase, liver type
UniProt Gene Name
PFKL
UniProt Synonym Gene Names
PFK-B
UniProt Entry Name
K6PL_HUMAN
Similar Products
Product Notes
The PFKL pfkl (Catalog #AAA199620) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PFKL antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PFKL can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PFKL pfkl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RTNVLGHLQQ GGAPTPFDRN YGTKLGVKAM LWLSEKLREV YRKGRVFANA. It is sometimes possible for the material contained within the vial of "PFKL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.