Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281575_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using PGC1α Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit PGC1alpha Polyclonal Antibody | anti-PGC1alpha antibody

PGC1alpha Rabbit pAb

Gene Names
PPARGC1A; LEM6; PGC1; PGC1A; PGC-1v; PPARGC1; PGC-1(alpha)
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
PGC1alpha, Antibody; PGC1alpha Rabbit pAb; PPARGC1A; LEM6; PGC-1(alpha); PGC-1alpha; PGC-1v; PGC1; PGC1A; PPARGC1; PPARG coactivator 1 alpha; PGC1 alpha; anti-PGC1alpha antibody
Ordering
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
FGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Applicable Applications for anti-PGC1alpha antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 700 to the C-terminus of human PGC1alpha (NP_037393.1).
Cellular Location
Cytoplasm, Nucleus, PML body
Positive Samples
Mouse skeletal muscle, Mouse kidney, Mouse heart, Rat heart
Species Reactivity/Cross-Reactivity
Human, Mouse, Rat
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide,50% glycerol,pH7.3.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using PGC1α Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281575_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using PGC1α Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded rat lung using PGC1α Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA281575_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded rat lung using PGC1α Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded mouse kidney using PGC1α Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA281575_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse kidney using PGC1α Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using PGC1α antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA281575_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using PGC1α antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-PGC1alpha antibody
Background: The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Observed MW: 91 kDa
Calculated MW: 14kDa/30kDa/31kDa/33kDa/77kDa/89kDa/91kDa
NCBI Official Full Name
peroxisome proliferator-activated receptor gamma coactivator 1-alpha
NCBI Official Synonym Full Names
peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
NCBI Official Symbol
PPARGC1A
NCBI Official Synonym Symbols
LEM6; PGC1; PGC1A; PGC-1v; PPARGC1; PGC-1(alpha)
NCBI Protein Information
peroxisome proliferator-activated receptor gamma coactivator 1-alpha; PGC-1-alpha; L-PGC-1alpha; PPARGC-1-alpha; ligand effect modulator-6; PPAR gamma coactivator variant form; peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcrip
UniProt Protein Name
Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
UniProt Gene Name
PPARGC1A
UniProt Synonym Gene Names
LEM6; PGC1; PGC1A; PPARGC1; PGC-1-alpha; PPAR-gamma coactivator 1-alpha
UniProt Entry Name
PRGC1_HUMAN

Similar Products

Product Notes

The PGC1alpha ppargc1a (Catalog #AAA281575) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PGC1alpha can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PGC1alpha ppargc1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FGEIEECTVN LRDDGDSYGF ITYRYTCDAF AALENGYTLR RSNETDFELY FCGRKQFFKS NYADLDSNSD DFDPASTKSK YDSLDFDSLL KEAQRSLRR. It is sometimes possible for the material contained within the vial of "PGC1alpha, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.