Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197719_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PGRC2Sample Type: Fetal Lung lysatesAntibody Dilution: 1ug/ml)

Rabbit PGRMC2 Polyclonal Antibody | anti-PGRMC2 antibody

PGRMC2 Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
PGRMC2; DG6; PMBP
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PGRMC2, Antibody; PGRMC2 Antibody - C-terminal region; anti-PGRMC2 antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
SDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQ
Applicable Applications for anti-PGRMC2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Protein Size (# AA)
223 amino acids
Protein Interactions
UBC; LMNA; ABCC1;
Blocking Peptide
For anti-PGRMC2 (MBS3201858) antibody is Catalog # MBS3226859
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PGRC2
Predicted Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: PGRC2Sample Type: Fetal Lung lysatesAntibody Dilution: 1ug/ml)

product-image-AAA197719_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PGRC2Sample Type: Fetal Lung lysatesAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-PGRC2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: Plasma membrane in spermatozoaPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA197719_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-PGRC2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: Plasma membrane in spermatozoaPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-PGRMC2 antibody
This is a rabbit polyclonal antibody against PGRC2. It was validated on Western Blot
Product Categories/Family for anti-PGRMC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
Membrane-associated progesterone receptor component 2
NCBI Official Synonym Full Names
progesterone receptor membrane component 2
NCBI Official Symbol
PGRMC2
NCBI Official Synonym Symbols
DG6; PMBP
NCBI Protein Information
membrane-associated progesterone receptor component 2
UniProt Protein Name
Membrane-associated progesterone receptor component 2
UniProt Gene Name
PGRMC2
UniProt Synonym Gene Names
DG6; PMBP
UniProt Entry Name
PGRC2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PGRMC2 pgrmc2 (Catalog #AAA197719) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PGRMC2 Antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PGRMC2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PGRMC2 pgrmc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SDLNAVQMES VREWEMQFKE KYDYVGRLLK PGEEPSEYTD EEDTKDHNKQ. It is sometimes possible for the material contained within the vial of "PGRMC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.