Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200137_WB13.jpg WB (Western Blot) (WB Suggested Anti-PHF6 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Rabbit PHF6 Polyclonal Antibody | anti-PHF6 antibody

PHF6 antibody - N-terminal region

Gene Names
PHF6; BFLS; BORJ; CENP-31
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
PHF6, Antibody; PHF6 antibody - N-terminal region; anti-PHF6 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFH
Sequence Length
365
Applicable Applications for anti-PHF6 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PHF6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PHF6 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

product-image-AAA200137_WB13.jpg WB (Western Blot) (WB Suggested Anti-PHF6 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

WB (Western Blot)

(Sample Type: HEK293T cells transfected with a plasmid for over expression of myc-tagged PHF6Primary Dilution: 1:1000Secondary (goat anti-rabbit HRP) Dilution: 1:1000)

product-image-AAA200137_WB15.jpg WB (Western Blot) (Sample Type: HEK293T cells transfected with a plasmid for over expression of myc-tagged PHF6Primary Dilution: 1:1000Secondary (goat anti-rabbit HRP) Dilution: 1:1000)
Related Product Information for anti-PHF6 antibody
This is a rabbit polyclonal antibody against PHF6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PHF6 is a member of the plant homeodomain (PHD)-like finger (PHF) family. PHF6 is a protein with two PHD-type zinc finger domains, indicating a potential role in transcriptional regulation that localizes to the nucleolus. Mutations affecting the coding region of its gene or the splicing of the transcript have been associated with Borjeson-Forssman-Lehmann syndrome (BFLS), a disorder characterized by mental retardation, epilepsy, hypogonadism, hypometabolism, obesity, swelling of subcutaneous tissue of the face, narrow palpebral fissures, and large ears.This gene is a member of the plant homeodomain (PHD)-like finger (PHF) family. It encodes a protein with two PHD-type zinc finger domains, indicating a potential role in transcriptional regulation, that localizes to the nucleolus. Mutations affecting the coding region of this gene or the splicing of the transcript have been associated with Borjeson-Forssman-Lehmann syndrome (BFLS), a disorder characterized by mental retardation, epilepsy, hypogonadism, hypometabolism, obesity, swelling of subcutaneous tissue of the face, narrow palpebral fissures, and large ears. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
PHD finger protein 6 isoform 1
NCBI Official Synonym Full Names
PHD finger protein 6
NCBI Official Symbol
PHF6
NCBI Official Synonym Symbols
BFLS; BORJ; CENP-31
NCBI Protein Information
PHD finger protein 6
UniProt Protein Name
PHD finger protein 6
UniProt Gene Name
PHF6
UniProt Synonym Gene Names
CENP-31; KIAA1823
UniProt Entry Name
PHF6_HUMAN

Similar Products

Product Notes

The PHF6 phf6 (Catalog #AAA200137) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHF6 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PHF6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PHF6 phf6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VGQNHSEDGA PALLTTAPPP GLQPGAGGTP GGPGGGGAPP RYATLEHPFH. It is sometimes possible for the material contained within the vial of "PHF6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.