WB (Western Blot)
(WB Suggested Anti-PHKG2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysatePHKG2 is supported by BioGPS gene expression data to be expressed in HepG2)
Rabbit PHKG2 Polyclonal Antibody | anti-PHKG2 antibody
PHKG2 antibody - N-terminal region
Gene Names
PHKG2; GSD9C
Reactivity
Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PHKG2, Antibody; PHKG2 antibody - N-terminal region; anti-PHKG2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV
Sequence Length
406
Applicable Applications for anti-PHKG2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PHKG2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PHKG2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysatePHKG2 is supported by BioGPS gene expression data to be expressed in HepG2)
WB (Western Blot)
(WB Suggested Anti-PHKG2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysatePHKG2 is supported by BioGPS gene expression data to be expressed in HepG2)
WB (Western Blot)
(Host: MouseTarget Name: PHKG2Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: PHKG2Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
IHC (Immunohistochemistry)
(Human kidney)
IHC (Immunohistochemistry)
(Human kidney)
Related Product Information for anti-PHKG2 antibody
This is a rabbit polyclonal antibody against PHKG2. It was validated on Western Blot and immunohistochemistry
Target Description: Mutations in PHKG2 along with PHKA2 and PHKB, all three different genes of phosphorylase kinase (Phk) subunits, can give rise to glycogen storage disease of the liver. The autosomal-recessive, liver-specific variant of Phk deficiency is caused by mutations in the gene encoding the testis/liver isoform of the catalytic gamma subunit, PHKG2.
Target Description: Mutations in PHKG2 along with PHKA2 and PHKB, all three different genes of phosphorylase kinase (Phk) subunits, can give rise to glycogen storage disease of the liver. The autosomal-recessive, liver-specific variant of Phk deficiency is caused by mutations in the gene encoding the testis/liver isoform of the catalytic gamma subunit, PHKG2.
Product Categories/Family for anti-PHKG2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
phosphorylase b kinase gamma catalytic chain, liver/testis isoform isoform 1
NCBI Official Synonym Full Names
phosphorylase kinase catalytic subunit gamma 2
NCBI Official Symbol
PHKG2
NCBI Official Synonym Symbols
GSD9C
NCBI Protein Information
phosphorylase b kinase gamma catalytic chain, liver/testis isoform
UniProt Protein Name
Phosphorylase b kinase gamma catalytic chain, liver/testis isoform
UniProt Gene Name
PHKG2
UniProt Synonym Gene Names
PHK-gamma-LT; PHK-gamma-T
UniProt Entry Name
PHKG2_HUMAN
Similar Products
Product Notes
The PHKG2 phkg2 (Catalog #AAA197518) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHKG2 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PHKG2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PHKG2 phkg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDELPDWAAA KEFYQKYDPK DVIGRGVSSV VRRCVHRATG HEFAVKIMEV. It is sometimes possible for the material contained within the vial of "PHKG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.