Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282278_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human breast cancer using Phospho-Histone H2A-S129 antibody at dilution of 1:100 (40x lens).)

Rabbit anti-Human, Rat Phospho-Histone H2A-S129 Polyclonal Antibody | anti-H2A-S129 antibody

Phospho-Histone H2A-S129 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
MIF; GIF; GLIF; MMIF
Reactivity
Human, Rat
Applications
Immunohistochemistry
Purity
Affinity purification
Synonyms
Phospho-Histone H2A-S129, Antibody; Phospho-Histone H2A-S129 Rabbit pAb; H2A1; SPT11; anti-H2A-S129 antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Applicable Applications for anti-H2A-S129 antibody
IHC (Immunohistochemistry)
Immunogen
A synthetic phosphorylated peptide around S129 of saccharomyces cerevisiae Histone H2A (NP_010511.3).
Cellular Location
nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human breast cancer using Phospho-Histone H2A-S129 antibody at dilution of 1:100 (40x lens).)

product-image-AAA282278_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human breast cancer using Phospho-Histone H2A-S129 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat liver using Phospho-Histone H2A-S129 antibody at dilution of 1:100 (40x lens).)

product-image-AAA282278_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat liver using Phospho-Histone H2A-S129 antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-H2A-S129 antibody
Core component of nucleosome which plays a central role in DNA double strand break (DSB) repair. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Product Categories/Family for anti-H2A-S129 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,476 Da
NCBI Official Full Name
macrophage migration inhibitory factor
NCBI Official Synonym Full Names
macrophage migration inhibitory factor (glycosylation-inhibiting factor)
NCBI Official Symbol
MIF
NCBI Official Synonym Symbols
GIF; GLIF; MMIF
NCBI Protein Information
macrophage migration inhibitory factor; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase
UniProt Protein Name
Macrophage migration inhibitory factor
UniProt Gene Name
MIF
UniProt Synonym Gene Names
GLIF; MMIF; MIF; GIF
UniProt Entry Name
MIF_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The H2A-S129 mif (Catalog #AAA282278) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Phospho-Histone H2A-S129 Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Phospho-Histone H2A-S129 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the H2A-S129 mif for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PMFIVNTNVP RASVPDGFLS ELTQQLAQAT GKPPQYIAVH VVPDQLMAFG GSSEPCALCS LHSIGKIGGA QNRSYSKLLC GLLAERLRIS PDRVYINYYD MNAANVGWNN STFA. It is sometimes possible for the material contained within the vial of "Phospho-Histone H2A-S129, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.