Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282246_ChIP11.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis of extracts of 293T; cells, using Phospho-POLR2A CTD-T4 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

Rabbit Phospho-POLR2A CTD-T4 Polyclonal Antibody | anti-POLR2ACTD-T4 antibody

Phospho-POLR2A CTD-T4 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
CASP1; ICE; P45; IL1BC
Reactivity
Human, Mouse, Rat
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
Phospho-POLR2A CTD-T4, Antibody; Phospho-POLR2A CTD-T4 Rabbit pAb; POLR2A; POLR2; POLRA; RPB1; RPBh1; RPO2; RPOL2; RpIILS; hRPB220; hsRPB1; Pol II; anti-POLR2ACTD-T4 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
VDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
Applicable Applications for anti-POLR2ACTD-T4 antibody
ChIP (Chromatin immunoprecipitation), IP (Immunoprecipitation), WB (Western Blot)
Positive Samples
MCF7, NIH/3T3, C2C12, C6, PC-12
Immunogen
A phospho specific peptide corresponding to residues surrounding T4 of human POLR2A CTD repeat YSPTSPS.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation analysis of extracts of 293T; cells, using Phospho-POLR2A CTD-T4 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

product-image-AAA282246_ChIP11.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis of extracts of 293T; cells, using Phospho-POLR2A CTD-T4 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300ug extracts of C6 cells using 3ug Phospho-POLR2A CTD-T4 antibody. Western blot was performed from the immunoprecipitate using Phospho-POLR2A (Thr4) antibody at a dilution of 1:1000.)

product-image-AAA282246_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300ug extracts of C6 cells using 3ug Phospho-POLR2A CTD-T4 antibody. Western blot was performed from the immunoprecipitate using Phospho-POLR2A (Thr4) antibody at a dilution of 1:1000.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using Phospho-POLR2A CTD-T4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA282246_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using Phospho-POLR2A CTD-T4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-POLR2ACTD-T4 antibody
This gene encodes the largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a carboxy terminal domain composed of heptapeptide repeats that are essential for polymerase activity. These repeats contain serine and threonine residues that are phosphorylated in actively transcribing RNA polymerase. In addition, this subunit, in combination with several other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which the DNA template is transcribed into RNA.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
834
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,159 Da
NCBI Official Full Name
caspase-1 isoform beta
NCBI Official Synonym Full Names
caspase 1, apoptosis-related cysteine peptidase
NCBI Official Symbol
CASP1
NCBI Official Synonym Symbols
ICE; P45; IL1BC
NCBI Protein Information
caspase-1; IL1B-convertase; CASP1 nirs variant 1; IL-1 beta-converting enzyme; interleukin 1, beta, convertase; interleukin 1-B converting enzyme; caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)
UniProt Protein Name
Caspase-1
UniProt Gene Name
CASP1
UniProt Synonym Gene Names
IL1BC; IL1BCE; CASP-1; IL-1BC; ICE
UniProt Entry Name
CASP1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The POLR2ACTD-T4 casp1 (Catalog #AAA282246) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Phospho-POLR2A CTD-T4 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Phospho-POLR2A CTD-T4 can be used in a range of immunoassay formats including, but not limited to, ChIP (Chromatin immunoprecipitation), IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the POLR2ACTD-T4 casp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VDVKKNLTAS DMTTELEAFA HRPEHKTSDS TFLVFMSHGI REGICGKKHS EQVPDILQLN AIFNMLNTKN CPSLKDKPKV IIIQACRGDS PGVVWFKDSV G. It is sometimes possible for the material contained within the vial of "Phospho-POLR2A CTD-T4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.