<
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded rat kidney using Phospho-Smad5-S463/S465 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
Rabbit Phospho-Smad5-S463/S465 Polyclonal Antibody | anti-Smad5-S463/S465 antibody
Phospho-Smad5-S463/S465 Rabbit pAb
Gene Names
DCX; DC; DBCN; LISX; SCLH; XLIS
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
Phospho-Smad5-S463/S465, Antibody; Phospho-Smad5-S463/S465 Rabbit pAb; DWFC; JV5-1; MADH5; anti-Smad5-S463/S465 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
SLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSLGDSM
Applicable Applications for anti-Smad5-S463/S465 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic phosphorylated peptide around S463 & S465 of human Phospho-Smad5-S463/S465 (NP_005894.3).
Cellular Location
cytoplasm, cytosol, nucleoplasm, nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded rat kidney using Phospho-Smad5-S463/S465 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
IHC (Immunohistochemistry)
(Immunohistochemistry of paraffin-embedded rat kidney using Phospho-Smad5-S463/S465 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
IHC (Immunohistochemisry)
(Immunohistochemistry of paraffin-embedded mouse kidney using Phospho-Smad5-S463/S465 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
IHC (Immunohistochemisry)
(Immunohistochemistry of paraffin-embedded mouse kidney using Phospho-Smad5-S463/S465 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded human kidney using Phospho-Smad5-S463/S465 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded human kidney using Phospho-Smad5-S463/S465 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
WB (Western Blot)
(Western blot analysis of extracts of NIH/3T3, using Phospho-Smad5-S463/S465 antibody at 1:675 dilution.NIH/3T3 cells were treated by BMP4 (50 ng/ml) at 37 degree C for 30 minutes after serum-starvation overnight.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of extracts of NIH/3T3, using Phospho-Smad5-S463/S465 antibody at 1:675 dilution.NIH/3T3 cells were treated by BMP4 (50 ng/ml) at 37 degree C for 30 minutes after serum-starvation overnight.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-Smad5-S463/S465 antibody
The protein encoded by this gene is involved in the transforming growth factor beta signaling pathway that results in an inhibition of the proliferation of hematopoietic progenitor cells. The encoded protein is activated by bone morphogenetic proteins type 1 receptor kinase, and may be involved in cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]
Product Categories/Family for anti-Smad5-S463/S465 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49,318 Da
NCBI Official Full Name
neuronal migration protein doublecortin isoform a
NCBI Official Synonym Full Names
doublecortin
NCBI Official Symbol
DCX
NCBI Official Synonym Symbols
DC; DBCN; LISX; SCLH; XLIS
NCBI Protein Information
neuronal migration protein doublecortin; lis-X; doublin; doublecortex; lissencephalin-X
UniProt Protein Name
Neuronal migration protein doublecortin
UniProt Gene Name
DCX
UniProt Synonym Gene Names
DBCN; LISX; Lis-X
UniProt Entry Name
DCX_HUMAN
Similar Products
Product Notes
The Smad5-S463/S465 dcx (Catalog #AAA282312) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Phospho-Smad5-S463/S465 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Phospho-Smad5-S463/S465 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the Smad5-S463/S465 dcx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SLDENECRVM KGNPSATAGP KASPTPQKTS AKSPGPMRRS KSPADSGNDQ DANGTSSSQL STPKSKQSPI STPTSPGSLR KHKDLYLPLS LDDSDSLGDS M. It is sometimes possible for the material contained within the vial of "Phospho-Smad5-S463/S465, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.