Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46839_WB15.jpg WB (Western Blot) (Western blot analysis of PIAS4 expression in rat testis extract (lane 1), mouse testis extract (lane 2) and HELA whole cell lysates (lane 3). PIAS4 at 57KD was detected using rabbit anti- PIAS4 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

Rabbit PIAS4 Polyclonal Antibody | anti-PIAS4 antibody

Anti-PIAS4 Antibody

Average rating 0.0
No ratings yet
Gene Names
PIAS4; PIASY; Piasg; ZMIZ6; PIAS-gamma
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
PIAS4, Antibody; Anti-PIAS4 Antibody; E3 SUMOprotein ligase PIAS4; E3 SUMO-protein ligase PIAS4; PIASG; PIASgamma; PIAS-gamma; PIASy; Q8N2W9; protein inhibitor of activated STAT, 4; anti-PIAS4 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
510
Applicable Applications for anti-PIAS4 antibody
WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human PIAS4 (130-174aa EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE), different from the related mouse sequence by two amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

WB (Western Blot)

(Western blot analysis of PIAS4 expression in rat testis extract (lane 1), mouse testis extract (lane 2) and HELA whole cell lysates (lane 3). PIAS4 at 57KD was detected using rabbit anti- PIAS4 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46839_WB15.jpg WB (Western Blot) (Western blot analysis of PIAS4 expression in rat testis extract (lane 1), mouse testis extract (lane 2) and HELA whole cell lysates (lane 3). PIAS4 at 57KD was detected using rabbit anti- PIAS4 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-PIAS4 antibody
Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase PIAS4(PIAS4) detection.
Background: E3 SUMO-protein ligase PIAS4, also known as protein inhibitor of activated STAT protein 4 (PIAS4) or protein inhibitor of activated STAT protein gamma (PIASg or PIASy), is an enzyme that in humans is encoded by the PIAS4 gene. This gene is mapped to 19p13.3. This gene plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. It also functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. This gene involved in gene silencing.
References
1. Bischof, O., Schwamborn, K., Martin, N., Werner, A., Sustmann, C., Grosschedl, R., Dejean, A. The E3 SUMO ligase PIASy is a regulator of cellular senescence and apoptosis. Molec. Cell 22: 783-794, 2006.
2. Galanty, Y., Belotserkovskaya, R., Coates, J., Polo, S., Miller, K. M., Jackson, S. P. Mammalian SUMO E3-ligases PIAS1 and PIAS4 promote responses to DNA double-strand breaks. Nature 462: 935-939, 2009.
3. Sachdev, S., Bruhn, L., Sieber, H., Pichler, A., Melchior, F., Grosschedl, R. PIASy, a nuclear matrix-associated SUMO E3 ligase, represses LEF1 activity by sequestration into nuclear bodies. Genes Dev. 15: 3088-3103, 2001.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
E3 SUMO-protein ligase PIAS4
NCBI Official Synonym Full Names
protein inhibitor of activated STAT 4
NCBI Official Symbol
PIAS4
NCBI Official Synonym Symbols
PIASY; Piasg; ZMIZ6; PIAS-gamma
NCBI Protein Information
E3 SUMO-protein ligase PIAS4
UniProt Protein Name
E3 SUMO-protein ligase PIAS4
UniProt Gene Name
PIAS4
UniProt Synonym Gene Names
PIASG; PIAS-gamma

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PIAS4 pias4 (Catalog #AAA46839) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-PIAS4 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PIAS4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PIAS4 pias4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIAS4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.