Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA131884_IHC10.jpg IHC (Immunohistochemistry) (DAB staining on IHC-P; Samples: Rat Spinal cord Tissue))

Rabbit Platelet Factor 4 (PF4) Polyclonal Antibody | anti-PF4 antibody

Polyclonal Antibody to Platelet Factor 4 (PF4)

Average rating 0.0
No ratings yet
Gene Names
Pf4; PF-4; Pf4a; Cxcl4; RATPF4A
Reactivity
Rat, Human, Mouse
Applications
Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry
Purity
Affinity Chromatography
Synonyms
Platelet Factor 4 (PF4), Antibody; Polyclonal Antibody to Platelet Factor 4 (PF4); anti-PF4 antibody
Ordering
Host
Rabbit
Reactivity
Rat, Human, Mouse
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against PF4. It has been selected for its ability to recognize PF4 in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
500ug/mL (varies by lot)
Sequence
Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-V TRASPEESDG DLSCVCVKTS SSRIHLKRIT SLEVIKAGPH CAVPQLIATL KNGSKICLDR QVPLYKKIIK KLLES
Sequence Length
101
Applicable Applications for anti-PF4 antibody
WB (Western Blot), ELISA, IHC (Immunohistochemistry), ICC (Immunocytochemistry)
Immunogen
Recombinant PF4 (Val30~Ser105) expressed in E.coli.
Cross Reactivity
Rat
Conjugated Antibody
The APC conjugated antibody version of this item is also available as
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

IHC (Immunohistochemistry)

(DAB staining on IHC-P; Samples: Rat Spinal cord Tissue))

product-image-AAA131884_IHC10.jpg IHC (Immunohistochemistry) (DAB staining on IHC-P; Samples: Rat Spinal cord Tissue))

IHC (Immunohistochemisry)

(DAB staining on IHC-P; Samples: Rat Testis Tissue))

product-image-AAA131884_IHC11.jpg IHC (Immunohistochemisry) (DAB staining on IHC-P; Samples: Rat Testis Tissue))

IHC (Immunohiostchemistry)

(DAB staining on fromalin fixed paraffin-embedded spleen tissue))

product-image-AAA131884_IHC13.jpg IHC (Immunohiostchemistry) (DAB staining on fromalin fixed paraffin-embedded spleen tissue))

WB (Western Blot)

(Western Blot: Sample: Recombinant protein.)

product-image-AAA131884_WB15.jpg WB (Western Blot) (Western Blot: Sample: Recombinant protein.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,287 Da
NCBI Official Full Name
platelet factor 4
NCBI Official Synonym Full Names
platelet factor 4
NCBI Official Symbol
Pf4
NCBI Official Synonym Symbols
PF-4; Pf4a; Cxcl4; RATPF4A
NCBI Protein Information
platelet factor 4
UniProt Protein Name
Platelet factor 4
UniProt Gene Name
Pf4
UniProt Synonym Gene Names
Cxcl4; Scyb4; PF-4

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PF4 pf4 (Catalog #AAA131884) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Platelet Factor 4 (PF4) reacts with Rat, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Platelet Factor 4 (PF4) can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA, IHC (Immunohistochemistry), ICC (Immunocytochemistry). Researchers should empirically determine the suitability of the PF4 pf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-V TRASPEESDG DLSCVCVKTS SSRIHLKRIT SLEVIKAGPH CAVPQLIATL KNGSKICLDR QVPLYKKIIK KLLES. It is sometimes possible for the material contained within the vial of "Platelet Factor 4 (PF4), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.