Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282028_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of mouse brain using PLP1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit anti-Mouse, Rat PLP1 Polyclonal Antibody | anti-PLP1 antibody

PLP1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
PLP1; PLP; PMD; HLD1; MMPL; SPG2; GPM6C; PLP/DM20
Reactivity
Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
PLP1, Antibody; PLP1 Rabbit pAb; PLP1; GPM6C; HLD1; MMPL; PLP; PLP/DM20; PMD; SPG2; anti-PLP1 antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
TWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFV
Applicable Applications for anti-PLP1 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 145-210 of human PLP1 (NP_955772.1).
Cellular Location
Cell membrane, Multi-pass membrane protein, Myelin membrane
Positive Samples
Mouse brain, Mouse heart, Mouse kidney, Rat brain, Rat kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of mouse brain using PLP1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282028_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of mouse brain using PLP1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of rat brain using PLP1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282028_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of rat brain using PLP1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse brain using PLP1 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA282028_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse brain using PLP1 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat brain using PLP1 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA282028_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat brain using PLP1 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using PLP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

product-image-AAA282028_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using PLP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Related Product Information for anti-PLP1 antibody
Background: This gene encodes a transmembrane proteolipid protein that is the predominant component of myelin. The encoded protein may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively splicing results in multiple transcript variants, including the DM20 splice variant.
Product Categories/Family for anti-PLP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
30,077 Da
NCBI Official Full Name
proteolipid protein, partial
NCBI Official Synonym Full Names
proteolipid protein 1
NCBI Official Symbol
PLP1
NCBI Official Synonym Symbols
PLP; PMD; HLD1; MMPL; SPG2; GPM6C; PLP/DM20
NCBI Protein Information
myelin proteolipid protein; lipophilin; major myelin proteolipid protein
UniProt Protein Name
Myelin proteolipid protein
UniProt Gene Name
PLP1
UniProt Synonym Gene Names
PLP; PLP
UniProt Entry Name
MYPR_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PLP1 plp1 (Catalog #AAA282028) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLP1 Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PLP1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PLP1 plp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TWTTCQSIAF PSKTSASIGS LCADARMYGV LPWNAFPGKV CGSNLLSICK TAEFQMTFHL FIAAFV. It is sometimes possible for the material contained within the vial of "PLP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.