Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201134_WB13.jpg WB (Western Blot) (WB Suggested Anti-PROSC AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Rabbit PLPBP Polyclonal Antibody | anti-PLPBP antibody

PLPBP Antibody - C-terminal region

Gene Names
PLPBP; PROSC; EPVB6D
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PLPBP, Antibody; PLPBP Antibody - C-terminal region; anti-PLPBP antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTPDKCAAD
Sequence Length
275
Applicable Applications for anti-PLPBP antibody
WB (Western Blot)
Homology
Dog: 85%; Guinea Pig: 100%; Human: 100%; Mouse: 85%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PROSC AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

product-image-AAA201134_WB13.jpg WB (Western Blot) (WB Suggested Anti-PROSC AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

WB (Western Blot)

(Host: RabbitTarget Name: PROSCSample Type: Human KidneyLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)

product-image-AAA201134_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: PROSCSample Type: Human KidneyLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)
Related Product Information for anti-PLPBP antibody
This is a rabbit polyclonal antibody against PROSC. It was validated on Western Blot

Target Description: This gene encodes a pyridoxal 5'-phosphate binding protein involved in the homeostatic regulation of intracellular pyridoxal 5'-phosphate. This gene has a tumor suppressive effect on hepatocellular carcinoma and other solid tumors of epithelial origin. Naturally occurring mutations in this gene are associated with a pyridoxine-dependent epilepsy.
Product Categories/Family for anti-PLPBP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
pyridoxal phosphate homeostasis protein isoform 2
NCBI Official Synonym Full Names
pyridoxal phosphate binding protein
NCBI Official Symbol
PLPBP
NCBI Official Synonym Symbols
PROSC; EPVB6D
NCBI Protein Information
pyridoxal phosphate homeostasis protein
UniProt Protein Name
Pyridoxal phosphate homeostasis protein
UniProt Gene Name
PLPBP
UniProt Synonym Gene Names
PLP homeostasis protein

Similar Products

Product Notes

The PLPBP plpbp (Catalog #AAA201134) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLPBP Antibody - C-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PLPBP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PLPBP plpbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PADQVELSMG MSADFQHAVE VGSTNVRIGS TIFGERDYSK KPTPDKCAAD. It is sometimes possible for the material contained within the vial of "PLPBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.