Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282323_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of HeLa cells, using 3 ug PLS3 antibody. Western blot was performed from the immunoprecipitate using PLS3 antibody at a dilution of 1:1000.)

Rabbit anti-Human PLS3 Polyclonal Antibody | anti-PLS3 antibody

PLS3 Rabbit pAb

Gene Names
C21orf33; ES1; HES1; KNPH; KNPI; GT335
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
PLS3, Antibody; PLS3 Rabbit pAb; PLS3; BMND18; T-plastin; plastin-3; anti-PLS3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
AARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Applicable Applications for anti-PLS3 antibody
IP (Immunoprecipitation), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human PLS3 (NP_005023.2).
Cellular Location
Cytoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 200ug extracts of HeLa cells, using 3 ug PLS3 antibody. Western blot was performed from the immunoprecipitate using PLS3 antibody at a dilution of 1:1000.)

product-image-AAA282323_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of HeLa cells, using 3 ug PLS3 antibody. Western blot was performed from the immunoprecipitate using PLS3 antibody at a dilution of 1:1000.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using PLS3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

product-image-AAA282323_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using PLS3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-PLS3 antibody
Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). The C-terminal 570 amino acids of the T-plastin and L-plastin proteins are 83% identical. It contains a potential calcium-binding site near the N terminus. Alternate splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,758 Da
NCBI Official Full Name
ES1 protein homolog, mitochondrial isoform Ia
NCBI Official Synonym Full Names
chromosome 21 open reading frame 33
NCBI Official Symbol
C21orf33
NCBI Official Synonym Symbols
ES1; HES1; KNPH; KNPI; GT335
NCBI Protein Information
ES1 protein homolog, mitochondrial; Keio novel protein I; human HES1 protein, homolog to E.coli and zebrafish ES1 protein
UniProt Protein Name
ES1 protein homolog, mitochondrial
UniProt Gene Name
C21orf33
UniProt Synonym Gene Names
HES1; KNPI
UniProt Entry Name
ES1_HUMAN

Similar Products

Product Notes

The PLS3 c21orf33 (Catalog #AAA282323) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLS3 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLS3 can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the PLS3 c21orf33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AARVALVLSG CGVYDGTEIH EASAILVHLS RGGAEVQIFA PDVPQMHVID HTKGQPSEGE SRNVLTESAR IARGKITDLA NLSAANHDAA IFPGGFGAAK NLSTFAVDGK DCKVNKEVER VLKEFHQAGK PIGLCCIAPV LAAKVLRGVE VTVGHEQEEG GKWPYAGTAE AIKALGAKHC VKEVVEAHVD QKNKVVTTPA FMCETALHYI HDGIGAMVRK VLELTGK. It is sometimes possible for the material contained within the vial of "PLS3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.