Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281145_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 150ug extracts of Jurkat cells using 3ug PMS2 antibody. Western blot was performed from the immunoprecipitate using PMS2 antibody at a dilition of 1:500.)

Rabbit anti-Human PMS2 Polyclonal Antibody | anti-PMS2 antibody

PMS2 Polyclonal Antibody

Gene Names
PMS2; MLH4; PMSL2; HNPCC4; PMS2CL
Reactivity
Human
Applications
Immunoprecipitation, Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
PMS2, Antibody; PMS2 Polyclonal Antibody; HNPCC4; MLH4; PMS2CL; PMSL2; anti-PMS2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
ADLEKPMVEKQDQSPSLRTGEEKKDVSISRLREAFSLRHTTENKPHSPKTPEPRRSPLGQKRGMLSSSTSGAISDKGVLRPQKEAVSSSHGPSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSSEYAASSPGDRGSQEHVDSQEKAPKTDDSFSDVDCHSNQEDTGCKFRVLPQPTNLATPNTKRFKKEEILSSSDICQKLVNTQDMSASQVDVAVKINKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQN
Sequence Length
862
Applicable Applications for anti-PMS2 antibody
IP (Immunoprecipitation), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant protein of human PMS2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 150ug extracts of Jurkat cells using 3ug PMS2 antibody. Western blot was performed from the immunoprecipitate using PMS2 antibody at a dilition of 1:500.)

product-image-AAA281145_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 150ug extracts of Jurkat cells using 3ug PMS2 antibody. Western blot was performed from the immunoprecipitate using PMS2 antibody at a dilition of 1:500.)

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using PMS2 antibody.)

product-image-AAA281145_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using PMS2 antibody.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using PMS2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA281145_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using PMS2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-PMS2 antibody
The protein encoded by this gene is a key component of the mismatch repair system that functions to correct DNA mismatches and small insertions and deletions that can occur during DNA replication and homologous recombination. This protein forms heterodimers with the gene product of the mutL homolog 1 (MLH1) gene to form the MutL-alpha heterodimer. The MutL-alpha heterodimer possesses an endonucleolytic activity that is activated following recognition of mismatches and insertion/deletion loops by the MutS-alpha and MutS-beta heterodimers, and is necessary for removal of the mismatched DNA. There is a DQHA(X)2E(X)4E motif found at the C-terminus of the protein encoded by this gene that forms part of the active site of the nuclease. Mutations in this gene have been associated with hereditary nonpolyposis colorectal cancer (HNPCC; also known as Lynch syndrome) and Turcot syndrome.
Product Categories/Family for anti-PMS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 20kDa; 51kDa; 62kDa; 95kDa
Observed: 120kDa
NCBI Official Full Name
mismatch repair endonuclease PMS2 isoform a
NCBI Official Synonym Full Names
PMS1 homolog 2, mismatch repair system component
NCBI Official Symbol
PMS2
NCBI Official Synonym Symbols
MLH4; PMSL2; HNPCC4; PMS2CL
NCBI Protein Information
mismatch repair endonuclease PMS2
UniProt Protein Name
Mismatch repair endonuclease PMS2
UniProt Gene Name
PMS2

Similar Products

Product Notes

The PMS2 pms2 (Catalog #AAA281145) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PMS2 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PMS2 can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the PMS2 pms2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ADLEKPMVEK QDQSPSLRTG EEKKDVSISR LREAFSLRHT TENKPHSPKT PEPRRSPLGQ KRGMLSSSTS GAISDKGVLR PQKEAVSSSH GPSDPTDRAE VEKDSGHGST SVDSEGFSIP DTGSHCSSEY AASSPGDRGS QEHVDSQEKA PKTDDSFSDV DCHSNQEDTG CKFRVLPQPT NLATPNTKRF KKEEILSSSD ICQKLVNTQD MSASQVDVAV KINKKVVPLD FSMSSLAKRI KQLHHEAQQS EGEQN. It is sometimes possible for the material contained within the vial of "PMS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.