Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IF (Immunofluorescence) (Immunofluorescence analysis of mouse pancreas using PNLIPRP1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit PNLIPRP1 Polyclonal Antibody | anti-PNLIPRP1 antibody

PNLIPRP1 Rabbit pAb

Gene Names
PNLIPRP1; PLRP1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
PNLIPRP1, Antibody; PNLIPRP1 Rabbit pAb; PLRP1; PNLIPRP1; anti-PNLIPRP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
FAAYPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEASNFARWRYGVSITLSGRTATGQIKVALFGNKGNTHQYSIFRGILKPGSTHSYEFDAKLDVGTIEKVKFLWNNNVINPTLPKVGATKITVQKGEEKTVYNFCSEDTVREDTLLTLTPC
Applicable Applications for anti-PNLIPRP1 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:100-1:200
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 298-467 of human PNLIPRP1 (NP_006220.1).
Positive Samples
BxPC-3, LO2, HepG2, Mouse pancreas, Mouse stomach, Mouse liver, Rat spleen, Rat liver
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of mouse pancreas using PNLIPRP1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of mouse pancreas using PNLIPRP1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of rat pancreas using PNLIPRP1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of rat pancreas using PNLIPRP1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of rat pancreas using PNLIPRP1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of rat pancreas using PNLIPRP1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse pancreas using PNLIPRP1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse pancreas using PNLIPRP1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human appendix using PNLIPRP1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human appendix using PNLIPRP1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat pancreas using PNLIPRP1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat pancreas using PNLIPRP1 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using PNLIPRP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

WB (Western Blot) (Western blot analysis of extracts of various cell lines, using PNLIPRP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,848 Da
NCBI Official Full Name
pancreatic lipase-related protein 1
NCBI Official Synonym Full Names
pancreatic lipase-related protein 1
NCBI Official Symbol
PNLIPRP1
NCBI Official Synonym Symbols
PLRP1
NCBI Protein Information
pancreatic lipase-related protein 1; PL-RP1; OTTHUMP00000020567; OTTHUMP00000230058; OTTHUMP00000230064
UniProt Protein Name
Pancreatic lipase-related protein 1
UniProt Gene Name
PNLIPRP1
UniProt Synonym Gene Names
PLRP1
UniProt Entry Name
LIPR1_HUMAN

Similar Products

Product Notes

The PNLIPRP1 pnliprp1 (Catalog #AAA28353) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PNLIPRP1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PNLIPRP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:100-1:200 IF: 1:50-1:200. Researchers should empirically determine the suitability of the PNLIPRP1 pnliprp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FAAYPCTSYK SFESDKCFPC PDQGCPQMGH YADKFAGRTS EEQQKFFLNT GEASNFARWR YGVSITLSGR TATGQIKVAL FGNKGNTHQY SIFRGILKPG STHSYEFDAK LDVGTIEKVK FLWNNNVINP TLPKVGATKI TVQKGEEKTV YNFCSEDTVR EDTLLTLTPC. It is sometimes possible for the material contained within the vial of "PNLIPRP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.