WB (Western Blot)
(WB Suggested Anti-POGZ Antibody Titration: 5.0ug/mlELISA Titer: 1:62500Positive Control: Human brain)
Rabbit POGZ Polyclonal Antibody | anti-POGZ antibody
POGZ antibody - N-terminal region
Gene Names
POGZ; MRD37; WHSUS; ZNF635; ZNF280E; ZNF635m
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
POGZ, Antibody; POGZ antibody - N-terminal region; anti-POGZ antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVA
Sequence Length
1410
Applicable Applications for anti-POGZ antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human POGZ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-POGZ Antibody Titration: 5.0ug/mlELISA Titer: 1:62500Positive Control: Human brain)
WB (Western Blot)
(WB Suggested Anti-POGZ Antibody Titration: 5.0ug/mlELISA Titer: 1:62500Positive Control: Human brain)
IHC (Immunohiostchemistry)
(Human Lung)
IHC (Immunohiostchemistry)
(Human Lung)
IHC (Immunohistochemistry)
(Human kidney)
IHC (Immunohistochemistry)
(Human kidney)
Related Product Information for anti-POGZ antibody
This is a rabbit polyclonal antibody against POGZ. It was validated on Western Blot and immunohistochemistry
Target Description: POGZ appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid systemThe protein encoded by this gene appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid system. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed.
Target Description: POGZ appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid systemThe protein encoded by this gene appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid system. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed.
Product Categories/Family for anti-POGZ antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
155kDa
NCBI Official Full Name
pogo transposable element with ZNF domain isoform 1
NCBI Official Synonym Full Names
pogo transposable element derived with ZNF domain
NCBI Official Symbol
POGZ
NCBI Official Synonym Symbols
MRD37; WHSUS; ZNF635; ZNF280E; ZNF635m
NCBI Protein Information
pogo transposable element with ZNF domain
UniProt Protein Name
Pogo transposable element with ZNF domain
UniProt Gene Name
POGZ
UniProt Synonym Gene Names
KIAA0461; SUHW5; ZNF280E; ZNF635
Similar Products
Product Notes
The POGZ pogz (Catalog #AAA198449) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POGZ antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's POGZ can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the POGZ pogz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EELEPWQKIS DVIEDSVVED YNSVDKTTTV SVSQQPVSAP VPIAAHASVA. It is sometimes possible for the material contained within the vial of "POGZ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.