<
WB (Western Blot)
(POLQ (polymerase (DNA directed), theta) Antibody (against the C terminal of POLQ) (50ug) validated by WB using Placenta Lysate at 0.2-1 ug/ml.)
Rabbit POLQ Polyclonal Antibody | anti-POLQ antibody
POLQ Antibody - C-terminal region
Gene Names
POLQ; PRO0327
Reactivity
Tested Reactivity: Human (Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat)
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POLQ, Antibody; POLQ Antibody - C-terminal region; anti-POLQ antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human (Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat)
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL
Sequence Length
1762
Applicable Applications for anti-POLQ antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human POLQ
Protein Size (#AA)
1762 amino acids
Protein Interactions
AP2S1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(POLQ (polymerase (DNA directed), theta) Antibody (against the C terminal of POLQ) (50ug) validated by WB using Placenta Lysate at 0.2-1 ug/ml.)
WB (Western Blot)
(POLQ (polymerase (DNA directed), theta) Antibody (against the C terminal of POLQ) (50ug) validated by WB using Placenta Lysate at 0.2-1 ug/ml.)
WB (Western Blot)
(Host: RabbitTarget Name: POLQSample Tissue: Human ThyroidAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: POLQSample Tissue: Human ThyroidAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: POLQSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: POLQSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: POLQSample Tissue: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: POLQSample Tissue: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Application Data
(Host: RabbitTarget: PQLQPositive Control (+): Human Placenta (PL)Negative Control (-): Human Liver (LI)Antibody Concentration: 1ug/ml)
Application Data
(Host: RabbitTarget: PQLQPositive Control (+): Human Placenta (PL)Negative Control (-): Human Liver (LI)Antibody Concentration: 1ug/ml)
Related Product Information for anti-POLQ antibody
This is a rabbit polyclonal antibody against POLQ. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links.
Target Description: POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links.
Product Categories/Family for anti-POLQ antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
180kDa
NCBI Official Full Name
polymerase (DNA directed), theta, isoform CRA_b
NCBI Official Synonym Full Names
DNA polymerase theta
NCBI Official Symbol
POLQ
NCBI Official Synonym Symbols
PRO0327
NCBI Protein Information
DNA polymerase theta
UniProt Protein Name
DNA polymerase theta
UniProt Gene Name
POLQ
UniProt Synonym Gene Names
POLH
UniProt Entry Name
DPOLQ_HUMAN
Similar Products
Product Notes
The POLQ polq (Catalog #AAA199981) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLQ Antibody - C-terminal region reacts with Tested Reactivity: Human (Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat) and may cross-react with other species as described in the data sheet. AAA Biotech's POLQ can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the POLQ polq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GHSFSFTSSD DIAEVLFLEL KLPPNREMKN QGSKKTLGST RRGIDNGRKL. It is sometimes possible for the material contained within the vial of "POLQ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.