Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281020_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of MCF7 cells using 1ug POLR2H antibody. Western blot was performed from the immunoprecipitate using POLR2H antibody at a dilition of 1:1000.)

Rabbit anti-Human, Mouse POLR2H Polyclonal Antibody | anti-POLR2H antibody

POLR2H Polyclonal Antibody

Gene Names
POLR2H; RPB8; RPB17; RPABC3
Reactivity
Human, Mouse
Applications
Immunoprecipitation, Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
POLR2H, Antibody; POLR2H Polyclonal Antibody; RPABC3; RPB17; RPB8; anti-POLR2H antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Sequence Length
175
Applicable Applications for anti-POLR2H antibody
IP (Immunoprecipitation), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant protein of human POLR2H
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus, nucleolus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 200ug extracts of MCF7 cells using 1ug POLR2H antibody. Western blot was performed from the immunoprecipitate using POLR2H antibody at a dilition of 1:1000.)

product-image-AAA281020_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of MCF7 cells using 1ug POLR2H antibody. Western blot was performed from the immunoprecipitate using POLR2H antibody at a dilition of 1:1000.)

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using POLR2H antibody. Blue: DAPI for nuclear staining.)

product-image-AAA281020_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using POLR2H antibody. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using POLR2H antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

product-image-AAA281020_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using POLR2H antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Related Product Information for anti-POLR2H antibody
The three eukaryotic RNA polymerases are complex multisubunit enzymes that play a central role in the transcription of nuclear genes. This gene encodes an essential and highly conserved subunit of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Alternative splicing results in multiple transcript variants of this gene.
Product Categories/Family for anti-POLR2H antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 9kDa; 12kDa; 13kDa; 17kDa; 19kDa
Observed: 17kDa
NCBI Official Full Name
DNA-directed RNA polymerases I, II, and III subunit RPABC3 isoform 1
NCBI Official Synonym Full Names
RNA polymerase II subunit H
NCBI Official Symbol
POLR2H
NCBI Official Synonym Symbols
RPB8; RPB17; RPABC3
NCBI Protein Information
DNA-directed RNA polymerases I, II, and III subunit RPABC3
UniProt Protein Name
DNA-directed RNA polymerases I, II, and III subunit RPABC3
UniProt Gene Name
POLR2H
UniProt Synonym Gene Names
RNA polymerases I, II, and III subunit ABC3; hRPB8

Similar Products

Product Notes

The POLR2H polr2h (Catalog #AAA281020) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLR2H Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's POLR2H can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the POLR2H polr2h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGILFEDIF DVKDIDPEGK KFDRVSRLHC ESESFKMDLI LDVNIQIYPV DLGDKFRLVI ASTLYEDGTL DDGEYNPTDD RPSRADQFEY VMYGKVYRIE GDETSTEAAT RLSAYVSYGG LLMRLQGDAN NLHGFEVDSR VYLLMKKLAF. It is sometimes possible for the material contained within the vial of "POLR2H, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.