Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200061_WB13.jpg WB (Western Blot) (WB Suggested Anti-FLJ23356 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)

Rabbit POMK Polyclonal Antibody | anti-POMK antibody

POMK Antibody - N-terminal region

Gene Names
POMK; SGK196; MDDGA12; MDDGC12
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POMK, Antibody; POMK Antibody - N-terminal region; anti-POMK antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSLEMKDDFLHGL
Sequence Length
350
Applicable Applications for anti-POMK antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ23356
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FLJ23356 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)

product-image-AAA200061_WB13.jpg WB (Western Blot) (WB Suggested Anti-FLJ23356 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)

WB (Western Blot)

(Lanes:Lane 1: 30ug mouse renal epithelial lysateLane 2: 30ug mouse renal epithelial lysateLane 3: 30ug mouse renal epithelial lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:2500Gene Name:FLJ23356Submitted by:Dr. JUNMING FAN,ECU)

product-image-AAA200061_WB15.jpg WB (Western Blot) (Lanes:Lane 1: 30ug mouse renal epithelial lysateLane 2: 30ug mouse renal epithelial lysateLane 3: 30ug mouse renal epithelial lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:2500Gene Name:FLJ23356Submitted by:Dr. JUNMING FAN,ECU)
Related Product Information for anti-POMK antibody
This is a rabbit polyclonal antibody against FLJ23356. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a protein that may be involved in the presentation of the laminin-binding O-linked carbohydrate chain of alpha-dystroglycan (a-DG), which forms transmembrane linkages between the extracellular matrix and the exoskeleton. Some pathogens use this O-linked carbohydrate unit for host entry. Loss of function compound heterozygous mutations in this gene were found in a human patient affected by the Walker-Warburg syndrome (WWS) phenotype. Mice lacking this gene contain misplaced neurons (heterotopia) in some regions of the brain, possibly from defects in neuronal migration. Alternative splicing of this gene results in multiple transcript variants.
Product Categories/Family for anti-POMK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
protein O-mannose kinase
NCBI Official Synonym Full Names
protein-O-mannose kinase
NCBI Official Symbol
POMK
NCBI Official Synonym Symbols
SGK196; MDDGA12; MDDGC12
NCBI Protein Information
protein O-mannose kinase
UniProt Protein Name
Protein O-mannose kinase
UniProt Gene Name
POMK
UniProt Synonym Gene Names
SGK196; POMK
UniProt Entry Name
SG196_HUMAN

Similar Products

Product Notes

The POMK pomk (Catalog #AAA200061) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POMK Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's POMK can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the POMK pomk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CEELRTEVRQ LKRVGEGAVK RVFLSEWKEH KVALSQLTSL EMKDDFLHGL. It is sometimes possible for the material contained within the vial of "POMK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.