WB (Western Blot)
(WB Suggested Anti-POPDC3 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Rabbit POPDC3 Polyclonal Antibody | anti-POPDC3 antibody
POPDC3 antibody - C-terminal region
Gene Names
POPDC3; POP3; bA355M14.1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POPDC3, Antibody; POPDC3 antibody - C-terminal region; anti-POPDC3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQ
Sequence Length
291
Applicable Applications for anti-POPDC3 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human POPDC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-POPDC3 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
WB (Western Blot)
(WB Suggested Anti-POPDC3 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: POPDC3Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: POPDC3Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-POPDC3 antibody
This is a rabbit polyclonal antibody against POPDC3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: POPDC3 is a member of the POP family of proteins containing three putative transmembrane domains. The protein is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development.This gene encodes a member of the POP family of proteins containing three putative transmembrane domains. This gene is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development.
Target Description: POPDC3 is a member of the POP family of proteins containing three putative transmembrane domains. The protein is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development.This gene encodes a member of the POP family of proteins containing three putative transmembrane domains. This gene is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development.
Product Categories/Family for anti-POPDC3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
popeye domain-containing protein 3
NCBI Official Synonym Full Names
popeye domain containing 3
NCBI Official Symbol
POPDC3
NCBI Official Synonym Symbols
POP3; bA355M14.1
NCBI Protein Information
popeye domain-containing protein 3
UniProt Protein Name
Popeye domain-containing protein 3
UniProt Gene Name
POPDC3
UniProt Synonym Gene Names
POP3; Popeye protein 3
Similar Products
Product Notes
The POPDC3 popdc3 (Catalog #AAA200028) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POPDC3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's POPDC3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the POPDC3 popdc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YLLFAQHRYI SRLFSVLIGS DIADKLYALN DRVYIGKRYH YDIRLPNFYQ. It is sometimes possible for the material contained within the vial of "POPDC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.