Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197161_WB10.jpg WB (Western Blot) (WB Suggested Anti-POU1F1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

Rabbit POU1F1 Polyclonal Antibody | anti-POU1F1 antibody

POU1F1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
POU1F1; PIT1; CPHD1; GHF-1; Pit-1; POU1F1a
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
POU1F1, Antibody; POU1F1 antibody - C-terminal region; anti-POU1F1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
Sequence Length
291
Applicable Applications for anti-POU1F1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human POU1F1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-POU1F1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

product-image-AAA197161_WB10.jpg WB (Western Blot) (WB Suggested Anti-POU1F1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: POU1F1Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA197161_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: POU1F1Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-POU1F1 AntibodyParaffin Embedded Tissue: Human pituitaryObserved staining: NuclearPrimary Antibody Dilution: 1:600Conditions: Primary antibody incubation at RT for 1 hour. Detection was done using HRP -polymer conjugated anti-rabbit secondary antibody by incubating for 30 minutes at RT.Chromogen: DABCounterstaining: Hematoxylin.)

product-image-AAA197161_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-POU1F1 AntibodyParaffin Embedded Tissue: Human pituitaryObserved staining: NuclearPrimary Antibody Dilution: 1:600Conditions: Primary antibody incubation at RT for 1 hour. Detection was done using HRP -polymer conjugated anti-rabbit secondary antibody by incubating for 30 minutes at RT.Chromogen: DABCounterstaining: Hematoxylin.)

IHC (Immunohistochemistry)

(Rabbit Anti-POU1F1 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocyteAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197161_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-POU1F1 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocyteAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-POU1F1 antibody
This is a rabbit polyclonal antibody against POU1F1. It was validated on Western Blot and immunohistochemistry

Target Description: PIT1 is a pituitary-specific transcription factor responsible for pituitary development and hormone expression in mammals and is a member of the POU family of transcription factors that regulate mammalian development. The POU family is so named because the first 3 members identified were PIT1 and OCT1 of mammals, and Unc-86 of C. elegans. PIT1 contains 2 protein domains, termed POU-specific and POU-homeo, which are both necessary for high affinity DNA binding on genes encoding growth hormone and prolactin. PIT1 is also important for regulation of the genes encoding prolactin and thyroid-stimulating hormone beta subunit by thyrotropin-releasing hormone and cyclic AMP.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
pituitary-specific positive transcription factor 1 isoform alpha
NCBI Official Synonym Full Names
POU class 1 homeobox 1
NCBI Official Symbol
POU1F1
NCBI Official Synonym Symbols
PIT1; CPHD1; GHF-1; Pit-1; POU1F1a
NCBI Protein Information
pituitary-specific positive transcription factor 1
UniProt Protein Name
Pituitary-specific positive transcription factor 1
UniProt Gene Name
POU1F1
UniProt Synonym Gene Names
GHF1; PIT1; PIT-1; GHF-1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The POU1F1 pou1f1 (Catalog #AAA197161) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POU1F1 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's POU1F1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the POU1F1 pou1f1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QEIMRMAEEL NLEKEVVRVW FCNRRQREKR VKTSLNQSLF SISKEHLECR. It is sometimes possible for the material contained within the vial of "POU1F1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.