Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197393_WB8.jpg WB (Western Blot) (WB Suggested Anti-POU2F3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit POU2F3 Polyclonal Antibody | anti-POU2F3 antibody

POU2F3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
POU2F3; PLA1; OCT11; PLA-1; Epoc-1; OCT-11; OTF-11; Skn-1a
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
POU2F3, Antibody; POU2F3 antibody - N-terminal region; anti-POU2F3 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
Sequence Length
436
Applicable Applications for anti-POU2F3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-POU2F3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA197393_WB8.jpg WB (Western Blot) (WB Suggested Anti-POU2F3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RatTarget Name: POU2F3Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

product-image-AAA197393_WB10.jpg WB (Western Blot) (Host: RatTarget Name: POU2F3Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

IHC (Immunohistochemisry)

(Sample Type :Mouse tongue tissuePrimary Antibody Dilution :1:100Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:500Color/Signal Descriptions :Red: POU2F3Gene Name :POU2F3Submitted by :Dr. Hong Wang, Monell Chemical Senses Center)

product-image-AAA197393_IHC11.jpg IHC (Immunohistochemisry) (Sample Type :Mouse tongue tissuePrimary Antibody Dilution :1:100Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:500Color/Signal Descriptions :Red: POU2F3Gene Name :POU2F3Submitted by :Dr. Hong Wang, Monell Chemical Senses Center)

IHC (Immunohiostchemistry)

(Rabbit Anti-POU2F3 antibodyFormalin Fixed Paraffin Embedded Tissue: Human SkinPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA197393_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-POU2F3 antibodyFormalin Fixed Paraffin Embedded Tissue: Human SkinPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

IHC (Immunohistochemistry)

(Human Muscle)

product-image-AAA197393_IHC15.jpg IHC (Immunohistochemistry) (Human Muscle)
Related Product Information for anti-POU2F3 antibody
This is a rabbit polyclonal antibody against POU2F3. It was validated on Western Blot and immunohistochemistry

Target Description: POU domain genes encode a family of highly conserved transacting factors that influence the transcriptional activity of several cell type-specific and ubiquitous genes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
POU domain, class 2, transcription factor 3 isoform 1
NCBI Official Synonym Full Names
POU class 2 homeobox 3
NCBI Official Symbol
POU2F3
NCBI Official Synonym Symbols
PLA1; OCT11; PLA-1; Epoc-1; OCT-11; OTF-11; Skn-1a
NCBI Protein Information
POU domain, class 2, transcription factor 3
UniProt Protein Name
POU domain, class 2, transcription factor 3
UniProt Gene Name
POU2F3
UniProt Synonym Gene Names
OTF11; PLA1; Oct-11; OTF-11
UniProt Entry Name
PO2F3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The POU2F3 pou2f3 (Catalog #AAA197393) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POU2F3 antibody - N-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's POU2F3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the POU2F3 pou2f3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KMSGDVADST DARSTLSQVE PGNDRKGLDF NRQIKTEDLS DSLQQTLSHR. It is sometimes possible for the material contained within the vial of "POU2F3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.