Rabbit Ppic Polyclonal Antibody | anti-PPIC antibody
Ppic antibody - N-terminal region
Gene Names
Ppic; CyP-20c
Reactivity
Tested Species Reactivity: MousePredicte Spexies Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Ppic, Antibody; Ppic antibody - N-terminal region; anti-PPIC antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Mouse
Predicte Spexies Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Predicte Spexies Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: SVTDKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYGYKG
Sequence Length
212
Applicable Applications for anti-PPIC antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Protein Size (# AA)
212 amino acids
Blocking Peptide
Ppic peptide ( ) is used for blocking the activity of Ppic antibody (MBS3207336)
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-PPIC antibody
Target Description: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Product Categories/Family for anti-PPIC antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase C
NCBI Official Synonym Full Names
peptidylprolyl isomerase C
NCBI Official Symbol
Ppic
NCBI Official Synonym Symbols
CyP-20c
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase C
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase C
UniProt Gene Name
Ppic
UniProt Synonym Gene Names
Cypc; PPIase C
UniProt Entry Name
PPIC_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The PPIC ppic (Catalog #AAA199434) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ppic antibody - N-terminal region reacts with Tested Species Reactivity: Mouse Predicte Spexies Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's Ppic can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PPIC ppic for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SVTDKVFFDV RIGDKDVGRI VIGLFGNVVP KTVENFVALA TGEKGYGYKG. It is sometimes possible for the material contained within the vial of "Ppic, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
