WB (Western Blot)
(WB Suggested Anti-PPP1R15A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Rabbit anti-Human PPP1R15A Polyclonal Antibody | anti-PPP1R15A antibody
PPP1R15A antibody - N-terminal region
Gene Names
PPP1R15A; GADD34
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PPP1R15A, Antibody; PPP1R15A antibody - N-terminal region; anti-PPP1R15A antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GMYGEREATSVPRGQGSQFADGQRAPLSPSLLIRTLQGSDKNPGEEKAEE
Sequence Length
674
Applicable Applications for anti-PPP1R15A antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PPP1R15A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
WB (Western Blot)
(WB Suggested Anti-PPP1R15A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
IHC (Immunohistochemistry)
(Rabbit Anti-PPP1R15A AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in mitochondriaPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-PPP1R15A AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in mitochondriaPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-PPP1R15A antibody
This is a rabbit polyclonal antibody against PPP1R15A. It was validated on Western Blot
Target Description: This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The induction of this gene by ionizing radiation occurs in certain cell lines regardless of p53 status, and its protein response is correlated with apoptosis following ionizing radiation.
Target Description: This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The induction of this gene by ionizing radiation occurs in certain cell lines regardless of p53 status, and its protein response is correlated with apoptosis following ionizing radiation.
Product Categories/Family for anti-PPP1R15A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
protein phosphatase 1 regulatory subunit 15A
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory subunit 15A
NCBI Official Symbol
PPP1R15A
NCBI Official Synonym Symbols
GADD34
NCBI Protein Information
protein phosphatase 1 regulatory subunit 15A
UniProt Protein Name
Protein phosphatase 1 regulatory subunit 15A
UniProt Gene Name
PPP1R15A
UniProt Synonym Gene Names
GADD34
UniProt Entry Name
PR15A_HUMAN
Similar Products
Product Notes
The PPP1R15A ppp1r15a (Catalog #AAA201232) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP1R15A antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R15A can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PPP1R15A ppp1r15a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GMYGEREATS VPRGQGSQFA DGQRAPLSPS LLIRTLQGSD KNPGEEKAEE. It is sometimes possible for the material contained within the vial of "PPP1R15A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.