Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198650_WB13.jpg WB (Western Blot) (WB Suggested Anti-PPP1R8 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)

Rabbit PPP1R8 Polyclonal Antibody | anti-PPP1R8 antibody

PPP1R8 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
PPP1R8; ARD1; ARD-1; NIPP1; NIPP-1; PRO2047
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
PPP1R8, Antibody; PPP1R8 antibody - middle region; anti-PPP1R8 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Specificity
This antibody recognizes isoform-gamma
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK
Sequence Length
127
Applicable Applications for anti-PPP1R8 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PPP1R8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PPP1R8 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)

product-image-AAA198650_WB13.jpg WB (Western Blot) (WB Suggested Anti-PPP1R8 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)

IHC (Immunohistochemistry)

(Rabbit Anti-PPP1R8 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198650_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-PPP1R8 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-PPP1R8 antibody
This is a rabbit polyclonal antibody against PPP1R8. It was validated on Western Blot and immunohistochemistry

Target Description: This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
nuclear inhibitor of protein phosphatase 1 isoform gamma
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory subunit 8
NCBI Official Symbol
PPP1R8
NCBI Official Synonym Symbols
ARD1; ARD-1; NIPP1; NIPP-1; PRO2047
NCBI Protein Information
nuclear inhibitor of protein phosphatase 1
UniProt Protein Name
Nuclear inhibitor of protein phosphatase 1
UniProt Gene Name
PPP1R8
UniProt Synonym Gene Names
ARD1; NIPP1; NIPP-1
UniProt Entry Name
PP1R8_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PPP1R8 ppp1r8 (Catalog #AAA198650) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP1R8 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R8 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PPP1R8 ppp1r8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PNLAPDVDLT PVVPSAVNMN PAPNPAVYNP EAVNEPKKKK YAKEAWPGKK. It is sometimes possible for the material contained within the vial of "PPP1R8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.