Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200433_WB11.jpg WB (Western Blot) (WB Suggested Anti-PRDX5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Lung)

Rabbit PRDX5 Polyclonal Antibody | anti-PRDX5 antibody

PRDX5 antibody - middle region

Gene Names
PRDX5; PLP; ACR1; B166; PRXV; PMP20; PRDX6; prx-V; SBBI10; AOEB166; HEL-S-55
Reactivity
Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRDX5, Antibody; PRDX5 antibody - middle region; anti-PRDX5 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI
Sequence Length
125
Applicable Applications for anti-PRDX5 antibody
WB (Western Blot)
Homology
Dog: 86%; Goat: 79%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 93%; Sheep: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PRDX5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PRDX5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Lung)

product-image-AAA200433_WB11.jpg WB (Western Blot) (WB Suggested Anti-PRDX5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Lung)

WB (Western Blot)

(Host: RabbitTarget Name: PRDX5Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200433_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PRDX5Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PRDX5Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA200433_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: PRDX5Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PRDX5 antibody
This is a rabbit polyclonal antibody against PRDX5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PRDX5 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms.This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-PRDX5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
peroxiredoxin-5, mitochondrial isoform c
NCBI Official Synonym Full Names
peroxiredoxin 5
NCBI Official Symbol
PRDX5
NCBI Official Synonym Symbols
PLP; ACR1; B166; PRXV; PMP20; PRDX6; prx-V; SBBI10; AOEB166; HEL-S-55
NCBI Protein Information
peroxiredoxin-5, mitochondrial

Similar Products

Product Notes

The PRDX5 (Catalog #AAA200433) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRDX5 antibody - middle region reacts with Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's PRDX5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PRDX5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TDLLLDDSLV SIFGNRRLKR FSMVVQDGIV KALNVEPDGT GLTCSLAPNI. It is sometimes possible for the material contained within the vial of "PRDX5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.