IF (Immunofluorescence)
(Immunofluorescence analysis of Hep G2 cells using PRELID1 Rabbit pAb(AAA283272) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
Rabbit anti-Human PRELID1 Polyclonal Antibody | anti-PRELID1 antibody
PRELID1 Rabbit pAb
Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry
Purity
Affinity purification
Synonyms
PRELID1, Antibody; PRELID1 Rabbit pAb; PX19; PRELI; SBBI12; CGI-106; anti-PRELID1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
PSKTLVETAKEAKEKAKETALAATEKAKDLASKAATKKQQQQQQFV
Applicable Applications for anti-PRELID1 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry)
Immunogen
Recombinant Protein corresponding to a sequence within amino acids 174-219 of human PRELID1(NP_037369.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of Hep G2 cells using PRELID1 Rabbit pAb(AAA283272) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of Hep G2 cells using PRELID1 Rabbit pAb(AAA283272) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using PRELID1 Rabbit pAb (AAA283272) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using PRELID1 Rabbit pAb (AAA283272) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using PRELID1 Rabbit pAb (AAA283272) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using PRELID1 Rabbit pAb (AAA283272) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
Related Product Information for anti-PRELID1 antibody
This gene encodes a member of the late embryogenesis abundant motif-containing protein family. The encoded protein is localized to mitochondria and may function as a cytoprotectant by regulating cell death and differentiation. Alternative splicing results in multiple transcript variants encoding different isoforms. Several related pseudogenes have been identified.
Product Categories/Family for anti-PRELID1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 25kDa
UniProt Protein Name
PRELI domain-containing protein 1, mitochondrial
UniProt Gene Name
PRELID1
UniProt Synonym Gene Names
PRELI
UniProt Entry Name
PRLD1_HUMAN
Similar Products
Product Notes
The PRELID1 prelid1 (Catalog #AAA283272) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRELID1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRELID1 can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PRELID1 prelid1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PSKTLVETAK EAKEKAKETA LAATEKAKDL ASKAATKKQQ QQQQFV. It is sometimes possible for the material contained within the vial of "PRELID1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.