Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200647_WB11.jpg WB (Western Blot) (WB Suggested Anti-PRKCH AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellPRKCH is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit PRKCH Polyclonal Antibody | anti-PRKCH antibody

PRKCH antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
PRKCH; PKCL; PKC-L; PRKCL; nPKC-eta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRKCH, Antibody; PRKCH antibody - N-terminal region; anti-PRKCH antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLEL
Sequence Length
683
Applicable Applications for anti-PRKCH antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PRKCH AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellPRKCH is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

product-image-AAA200647_WB11.jpg WB (Western Blot) (WB Suggested Anti-PRKCH AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellPRKCH is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

WB (Western Blot)

(Host: RabbitTarget Name: PRKCHSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA200647_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PRKCHSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: PRKCHSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA200647_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: PRKCHSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-PRKCH antibody
This is a rabbit polyclonal antibody against PRKCH. It was validated on Western Blot

Target Description: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. It is a calcium-independent and phospholipids-dependent protein kinase. It is predominantly expressed in epithelial tissues and has been shown to reside specifically in the cell nucleus. This protein kinase can regulate keratinocyte differentiation by activating the MAP kinase MAPK13 (p38delta)-activated protein kinase cascade that targets CCAAT/enhancer-binding protein alpha (CEBPA). It is also found to mediate the transcription activation of the transglutaminase 1 (TGM1) gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
protein kinase C eta type
NCBI Official Synonym Full Names
protein kinase C eta
NCBI Official Symbol
PRKCH
NCBI Official Synonym Symbols
PKCL; PKC-L; PRKCL; nPKC-eta
NCBI Protein Information
protein kinase C eta type
UniProt Protein Name
Protein kinase C eta type
UniProt Gene Name
PRKCH
UniProt Synonym Gene Names
PKCL; PRKCL
UniProt Entry Name
KPCL_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PRKCH prkch (Catalog #AAA200647) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKCH antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PRKCH can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PRKCH prkch for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KKGHQLLDPY LTVSVDQVRV GQTSTKQKTN KPTYNEEFCA NVTDGGHLEL. It is sometimes possible for the material contained within the vial of "PRKCH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.