Rabbit PRL7A2 Polyclonal Antibody | anti-PRL7A2 antibody
PRL7A2 Antibody - middle region
Gene Names
Prl7a2; Ghd18; PLP-F; Prlpf
Reactivity
RatPredicted: Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
PRL7A2, Antibody; PRL7A2 Antibody - middle region; anti-PRL7A2 antibody
Host
Rabbit
Reactivity
Rat
Predicted: Mouse
Predicted: Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: TYTVNQVSEKLYENYMLDFIEDMEYLVKALTCCHNYSIKTPENLDEAQQI
Sequence Length
250
Applicable Applications for anti-PRL7A2 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse PRL7A2
Protein Size
250 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-PRL7A2 antibody
The function of this protein remains unknown.
Product Categories/Family for anti-PRL7A2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27 kDa
NCBI Official Full Name
prolactin-7A2
NCBI Official Synonym Full Names
prolactin family 7, subfamily a, member 2
NCBI Official Symbol
Prl7a2
NCBI Official Synonym Symbols
Ghd18; PLP-F; Prlpf
NCBI Protein Information
prolactin-7A2
UniProt Protein Name
Prolactin-7A2
UniProt Gene Name
Prl7a2
UniProt Synonym Gene Names
Prl7a3; Prlpf; PLP-F; PRL-like protein F
Similar Products
Product Notes
The PRL7A2 prl7a2 (Catalog #AAA201641) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRL7A2 Antibody - middle region reacts with Rat Predicted: Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PRL7A2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PRL7A2 prl7a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TYTVNQVSEK LYENYMLDFI EDMEYLVKAL TCCHNYSIKT PENLDEAQQI. It is sometimes possible for the material contained within the vial of "PRL7A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
