Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198581_WB10.jpg WB (Western Blot) (WB Suggested Anti-PRMT2 Antibody Titration: 0.625ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit PRMT2 Polyclonal Antibody | anti-PRMT2 antibody

PRMT2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
PRMT2; HRMT1L1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
PRMT2, Antibody; PRMT2 antibody - N-terminal region; anti-PRMT2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL
Sequence Length
433
Applicable Applications for anti-PRMT2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PRMT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PRMT2 Antibody Titration: 0.625ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

product-image-AAA198581_WB10.jpg WB (Western Blot) (WB Suggested Anti-PRMT2 Antibody Titration: 0.625ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(PRMT2 antibody - N-terminal region validated by WB using human LCL and mouse brains at 1:1000.)

product-image-AAA198581_WB11.jpg WB (Western Blot) (PRMT2 antibody - N-terminal region validated by WB using human LCL and mouse brains at 1:1000.)

IHC (Immunohiostchemistry)

(Rabbit Anti-PRMT2 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: Liver cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198581_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-PRMT2 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: Liver cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-PRMT2 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198581_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-PRMT2 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-PRMT2 antibody
This is a rabbit polyclonal antibody against PRMT2. It was validated on Western Blot and immunohistochemistry

Target Description: The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
protein arginine N-methyltransferase 2 isoform 1
NCBI Official Synonym Full Names
protein arginine methyltransferase 2
NCBI Official Symbol
PRMT2
NCBI Official Synonym Symbols
HRMT1L1
NCBI Protein Information
protein arginine N-methyltransferase 2
UniProt Protein Name
Protein arginine N-methyltransferase 2
UniProt Gene Name
PRMT2
UniProt Synonym Gene Names
HMT1; HRMT1L1
UniProt Entry Name
ANM2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PRMT2 prmt2 (Catalog #AAA198581) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRMT2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRMT2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PRMT2 prmt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESQGEEPAEC SEAGLLQEGV QPEEFVAIAD YAATDETQLS FLRGEKILIL. It is sometimes possible for the material contained within the vial of "PRMT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.